Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3903
Gene name Gene Name - the full gene name approved by the HGNC.
Leukocyte associated immunoglobulin like receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LAIR1
Synonyms (NCBI Gene) Gene synonyms aliases
CD305, LAIR-1
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.42
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including natural killer cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gen
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT037585 hsa-miR-744-5p CLASH 23622248
MIRT713284 hsa-miR-181a-2-3p HITS-CLIP 19536157
MIRT713283 hsa-miR-1273g-3p HITS-CLIP 19536157
MIRT713282 hsa-miR-6511a-3p HITS-CLIP 19536157
MIRT713281 hsa-miR-6511b-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0005515 Function Protein binding IPI 10660620, 10764762, 16754721
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane TAS
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602992 6477 ENSG00000167613
Protein
UniProt ID Q6GTX8
Protein name Leukocyte-associated immunoglobulin-like receptor 1 (LAIR-1) (hLAIR1) (CD antigen CD305)
Protein function Functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of natural killer (NK) cells, B-cells and T-cells. Activation by Tyr phosphorylation results in recruitment and activation of the phosph
PDB 3KGR , 3RP1 , 7F9L , 7F9M , 7F9N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 28 120 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on the majority of peripheral mononuclear cells, including natural killer (NK) cells, T-cells, B-cells, monocytes, and dendritic cells. Highly expressed in naive T-cells and B-cells but no expression on germinal center B-cell
Sequence
MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRL
ERESRSTYNDTEDVSQASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLV

KETSGGPDSPDTEPGSSAGPTQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFLFCLLL
LVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSA
LAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
Sequence length 287
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Neutrophil degranulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Glomerulonephritis IGA Glomerulonephritis rs778043831 25133636
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Stimulate 36960400
Arthritis Rheumatoid Associate 29328500
Autoimmune Diseases Associate 29915163
Breast Neoplasms Associate 33053017
Carcinoma Hepatocellular Stimulate 36293412
Carcinoma Hepatocellular Associate 37406019, 37647449
Carcinoma Non Small Cell Lung Associate 36960400
Chemical and Drug Induced Liver Injury Associate 31019980
Chromosome Aberrations Associate 20839337
Chromosome Aberrations Inhibit 24415628