Gene Gene information from NCBI Gene database.
Entrez ID 3903
Gene name Leukocyte associated immunoglobulin like receptor 1
Gene symbol LAIR1
Synonyms (NCBI Gene)
CD305LAIR-1
Chromosome 19
Chromosome location 19q13.42
Summary The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including natural killer cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gen
miRNA miRNA information provided by mirtarbase database.
260
miRTarBase ID miRNA Experiments Reference
MIRT037585 hsa-miR-744-5p CLASH 23622248
MIRT713284 hsa-miR-181a-2-3p HITS-CLIP 19536157
MIRT713283 hsa-miR-1273g-3p HITS-CLIP 19536157
MIRT713282 hsa-miR-6511a-3p HITS-CLIP 19536157
MIRT713281 hsa-miR-6511b-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0005515 Function Protein binding IPI 10660620, 10764762, 16754721
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602992 6477 ENSG00000167613
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6GTX8
Protein name Leukocyte-associated immunoglobulin-like receptor 1 (LAIR-1) (hLAIR1) (CD antigen CD305)
Protein function Functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of natural killer (NK) cells, B-cells and T-cells. Activation by Tyr phosphorylation results in recruitment and activation of the phosph
PDB 3KGR , 3RP1 , 7F9L , 7F9M , 7F9N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 28 120 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on the majority of peripheral mononuclear cells, including natural killer (NK) cells, T-cells, B-cells, monocytes, and dendritic cells. Highly expressed in naive T-cells and B-cells but no expression on germinal center B-cell
Sequence
MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRL
ERESRSTYNDTEDVSQASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLV

KETSGGPDSPDTEPGSSAGPTQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFLFCLLL
LVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSA
LAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
Sequence length 287
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Neutrophil degranulation