Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
389400
Gene name Gene Name - the full gene name approved by the HGNC.
GDNF family receptor alpha like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GFRAL
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf144, GRAL, UNQ9356, bA360D14.1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p12.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT488930 hsa-miR-5197-3p PAR-CLIP 23592263
MIRT488928 hsa-miR-6758-5p PAR-CLIP 23592263
MIRT488927 hsa-miR-6856-5p PAR-CLIP 23592263
MIRT488926 hsa-miR-1253 PAR-CLIP 23592263
MIRT488925 hsa-miR-3150b-3p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000187 Process Activation of MAPK activity IDA 28953886
GO:0002023 Process Reduction of food intake in response to dietary excess ISS
GO:0005515 Function Protein binding IPI 28846097, 28846098, 28846099, 28953886
GO:0007399 Process Nervous system development IBA 21873635
GO:0009897 Component External side of plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617837 32789 ENSG00000187871
Protein
UniProt ID Q6UXV0
Protein name GDNF family receptor alpha-like
Protein function Brainstem-restricted receptor for GDF15 hormone, which triggers an aversive response, characterized by nausea, vomiting, and/or loss of appetite in response to various stresses (PubMed:28846097, PubMed:28846098, PubMed:28846099, PubMed:28953886,
PDB 5VZ4 , 6Q2J , 6WMW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02351 GDNF 131 210 GDNF/GAS1 domain Domain
PF02351 GDNF 220 316 GDNF/GAS1 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the brainstem, restricted to cells in the area postrema and the immediately adjacent region of the nucleus tractus solitarius (at protein level) (PubMed:28846097, PubMed:28846098). Detected at low levels in testis and adip
Sequence
MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKM
RNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTR
SHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPF
NIAQMLAFCDCAQSDIPCQQSKEALHSKTC
AVNMVPPPTCLSVIRSCQNDELCRRHYRTF
QSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSE
ESLCKIFQHMLHRKSC
FNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMT
VTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL
Sequence length 394
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Associations from Text Mining
Disease Name Relationship Type References
Anorexia Associate 30772304
Blood Platelet Disorders Associate 38254638
Cachexia Associate 30772304
Insulin Resistance Associate 33302552
Obesity Associate 33302552
Stomach Neoplasms Associate 37260027