Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	388325
Gene name	SLP adaptor and CSK interacting membrane protein
Gene symbol	SCIMP
Synonyms (NCBI Gene)	C17orf87UNQ5783
Chromosome	17
Chromosome location	17p13.2
Summary	This gene encodes a transmembrane adaptor protein that is expressed in antigen-presenting cells and is localized in the immunologic synapse. The encoded protein is involved in major histocompatibility complex class II signal transduction and immune synaps

Show/Hide all (99)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017059	hsa-miR-335-5p	Microarray	18185580
MIRT689487	hsa-miR-548ac	HITS-CLIP	23313552
MIRT689486	hsa-miR-548bb-3p	HITS-CLIP	23313552
MIRT689485	hsa-miR-548d-3p	HITS-CLIP	23313552
MIRT689484	hsa-miR-548h-3p	HITS-CLIP	23313552
MIRT689483	hsa-miR-548z	HITS-CLIP	23313552
MIRT689482	hsa-miR-548ae-3p	HITS-CLIP	23313552
MIRT689481	hsa-miR-548ah-3p	HITS-CLIP	23313552
MIRT689480	hsa-miR-548aj-3p	HITS-CLIP	23313552
MIRT689479	hsa-miR-548am-3p	HITS-CLIP	23313552
MIRT689478	hsa-miR-548aq-3p	HITS-CLIP	23313552
MIRT689477	hsa-miR-548j-3p	HITS-CLIP	23313552
MIRT689476	hsa-miR-548x-3p	HITS-CLIP	23313552
MIRT689475	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT689474	hsa-miR-495-3p	HITS-CLIP	23313552
MIRT689473	hsa-miR-5688	HITS-CLIP	23313552
MIRT689472	hsa-miR-338-3p	HITS-CLIP	23313552
MIRT689471	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT689470	hsa-miR-340-3p	HITS-CLIP	23313552
MIRT689469	hsa-miR-6827-3p	HITS-CLIP	23313552
MIRT689468	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT689467	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT689466	hsa-miR-4435	HITS-CLIP	23313552
MIRT676127	hsa-miR-3155a	HITS-CLIP	23824327
MIRT676126	hsa-miR-3155b	HITS-CLIP	23824327
MIRT676125	hsa-miR-484	HITS-CLIP	23824327
MIRT676124	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT676123	hsa-miR-764	HITS-CLIP	23824327
MIRT676122	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT676121	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT676120	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT676119	hsa-miR-4454	HITS-CLIP	23824327
MIRT676118	hsa-miR-6131	HITS-CLIP	23824327
MIRT676117	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT676116	hsa-miR-5587-5p	HITS-CLIP	23824327
MIRT676115	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT676114	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT661229	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT661228	hsa-miR-3126-5p	HITS-CLIP	23824327
MIRT661227	hsa-miR-6875-5p	HITS-CLIP	23824327
MIRT661225	hsa-miR-4419a	HITS-CLIP	23824327
MIRT661226	hsa-miR-4510	HITS-CLIP	23824327
MIRT661224	hsa-miR-6127	HITS-CLIP	23824327
MIRT661223	hsa-miR-6129	HITS-CLIP	23824327
MIRT661222	hsa-miR-6130	HITS-CLIP	23824327
MIRT661221	hsa-miR-6133	HITS-CLIP	23824327
MIRT661220	hsa-miR-6834-5p	HITS-CLIP	23824327
MIRT661219	hsa-miR-1226-5p	HITS-CLIP	23824327
MIRT661218	hsa-miR-6734-5p	HITS-CLIP	23824327
MIRT661217	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT689487	hsa-miR-548ac	HITS-CLIP	23313552
MIRT689486	hsa-miR-548bb-3p	HITS-CLIP	23313552
MIRT689485	hsa-miR-548d-3p	HITS-CLIP	23313552
MIRT689484	hsa-miR-548h-3p	HITS-CLIP	23313552
MIRT689483	hsa-miR-548z	HITS-CLIP	23313552
MIRT689482	hsa-miR-548ae-3p	HITS-CLIP	23313552
MIRT689481	hsa-miR-548ah-3p	HITS-CLIP	23313552
MIRT689480	hsa-miR-548aj-3p	HITS-CLIP	23313552
MIRT689479	hsa-miR-548am-3p	HITS-CLIP	23313552
MIRT689478	hsa-miR-548aq-3p	HITS-CLIP	23313552
MIRT689477	hsa-miR-548j-3p	HITS-CLIP	23313552
MIRT689476	hsa-miR-548x-3p	HITS-CLIP	23313552
MIRT689475	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT689474	hsa-miR-495-3p	HITS-CLIP	23313552
MIRT689473	hsa-miR-5688	HITS-CLIP	23313552
MIRT689472	hsa-miR-338-3p	HITS-CLIP	23313552
MIRT689471	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT689470	hsa-miR-340-3p	HITS-CLIP	23313552
MIRT689469	hsa-miR-6827-3p	HITS-CLIP	23313552
MIRT689468	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT689467	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT689466	hsa-miR-4435	HITS-CLIP	23313552
MIRT676127	hsa-miR-3155a	HITS-CLIP	23824327
MIRT676126	hsa-miR-3155b	HITS-CLIP	23824327
MIRT676125	hsa-miR-484	HITS-CLIP	23824327
MIRT676124	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT676123	hsa-miR-764	HITS-CLIP	23824327
MIRT676122	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT676121	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT676120	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT676119	hsa-miR-4454	HITS-CLIP	23824327
MIRT676118	hsa-miR-6131	HITS-CLIP	23824327
MIRT676117	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT676116	hsa-miR-5587-5p	HITS-CLIP	23824327
MIRT676115	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT676114	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT661229	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT661228	hsa-miR-3126-5p	HITS-CLIP	23824327
MIRT661227	hsa-miR-6875-5p	HITS-CLIP	23824327
MIRT661225	hsa-miR-4419a	HITS-CLIP	23824327
MIRT661226	hsa-miR-4510	HITS-CLIP	23824327
MIRT661224	hsa-miR-6127	HITS-CLIP	23824327
MIRT661223	hsa-miR-6129	HITS-CLIP	23824327
MIRT661222	hsa-miR-6130	HITS-CLIP	23824327
MIRT661221	hsa-miR-6133	HITS-CLIP	23824327
MIRT661220	hsa-miR-6834-5p	HITS-CLIP	23824327
MIRT661219	hsa-miR-1226-5p	HITS-CLIP	23824327
MIRT661218	hsa-miR-6734-5p	HITS-CLIP	23824327
MIRT661217	hsa-miR-4446-5p	HITS-CLIP	23824327

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0001726	Component	Ruffle	IEA
GO:0001726	Component	Ruffle	ISS
GO:0001772	Component	Immunological synapse	IBA
GO:0001772	Component	Immunological synapse	IDA	21930792
GO:0001772	Component	Immunological synapse	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	ISS
GO:0002732	Process	Positive regulation of dendritic cell cytokine production	IEA
GO:0002732	Process	Positive regulation of dendritic cell cytokine production	ISS
GO:0005515	Function	Protein binding	IPI	21930792, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IDA	21930792
GO:0016020	Component	Membrane	IEA
GO:0030175	Component	Filopodium	IEA
GO:0030175	Component	Filopodium	IEA
GO:0030175	Component	Filopodium	ISS
GO:0031256	Component	Leading edge membrane	IDA	21930792
GO:0031259	Component	Uropod membrane	IDA	21930792
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IEA
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IEA
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	ISS
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IEA
GO:0034138	Process	Toll-like receptor 3 signaling pathway	ISS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IEA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	ISS
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IEA
GO:0034154	Process	Toll-like receptor 7 signaling pathway	ISS
GO:0038123	Process	Toll-like receptor TLR1:TLR2 signaling pathway	IEA
GO:0038123	Process	Toll-like receptor TLR1:TLR2 signaling pathway	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043235	Component	Receptor complex	IEA
GO:0043235	Component	Receptor complex	ISS
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045335	Component	Phagocytic vesicle	ISS
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0060090	Function	Molecular adaptor activity	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	21930792
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071226	Process	Cellular response to molecule of fungal origin	IEA
GO:0071226	Process	Cellular response to molecule of fungal origin	ISS
GO:0097197	Component	Tetraspanin-enriched microdomain	IDA	21930792
GO:0097197	Component	Tetraspanin-enriched microdomain	IEA

MIM	HGNC	e!Ensembl
614406	33504	ENSG00000161929

Q6UWF3

Protein name

SLP adapter and CSK-interacting membrane protein (SLP65/SLP76, Csk-interacting membrane protein)

Protein function

Lipid tetraspanin-associated transmembrane adapter/mediator that acts as a scaffold for Src-family kinases and other signaling proteins in immune cells (PubMed:21930792). It is involved in major histocompatibility complex class II (MHC-II) signa

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15050	SCIMP	12 → 143	SCIMP protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in antigen-presenting cells, like peripheral blood leukocytes and monocyte-derived dendritic cells (MDDC) (at protein level) (PubMed:21930792). Highly expressed in lymph nodes and spleen. Expressed in antigen-presenting cells

Sequence

MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKH
KQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVS
IPSYIEPEDDYDDVEIPANTEKASF

Sequence length

145

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and neck cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	31473137, 33152005	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammation	Associate	37658353	★★★★★ ★☆☆☆☆ Found in Text Mining only

SCIMP (SLP adaptor and CSK interacting membrane protein)