Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3880
Gene name Gene Name - the full gene name approved by the HGNC.	Keratin 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KRT19
Synonyms (NCBI Gene) Gene synonyms aliases	CK19, K19, K1CS
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratin

Show/Hide all(66)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016304	hsa-miR-193b-3p	Proteomics	21512034
MIRT016860	hsa-miR-335-5p	Microarray	18185580
MIRT1101175	hsa-miR-1207-5p	CLIP-seq
MIRT1101176	hsa-miR-1253	CLIP-seq
MIRT1101177	hsa-miR-1912	CLIP-seq
MIRT1101178	hsa-miR-298	CLIP-seq
MIRT1101179	hsa-miR-3130-5p	CLIP-seq
MIRT1101180	hsa-miR-3619-3p	CLIP-seq
MIRT1101181	hsa-miR-3667-3p	CLIP-seq
MIRT1101182	hsa-miR-4323	CLIP-seq
MIRT1101183	hsa-miR-4433	CLIP-seq
MIRT1101184	hsa-miR-4434	CLIP-seq
MIRT1101185	hsa-miR-4459	CLIP-seq
MIRT1101186	hsa-miR-4482	CLIP-seq
MIRT1101187	hsa-miR-4516	CLIP-seq
MIRT1101188	hsa-miR-4535	CLIP-seq
MIRT1101189	hsa-miR-4736	CLIP-seq
MIRT1101190	hsa-miR-4763-3p	CLIP-seq
MIRT1101191	hsa-miR-4768-3p	CLIP-seq
MIRT1101192	hsa-miR-4776-5p	CLIP-seq
MIRT1101193	hsa-miR-4780	CLIP-seq
MIRT1101194	hsa-miR-4787-5p	CLIP-seq
MIRT1101195	hsa-miR-513a-3p	CLIP-seq
MIRT1101196	hsa-miR-555	CLIP-seq
MIRT1101197	hsa-miR-623	CLIP-seq
MIRT1101198	hsa-miR-642a	CLIP-seq
MIRT1101199	hsa-miR-922	CLIP-seq
MIRT1101175	hsa-miR-1207-5p	CLIP-seq
MIRT1101176	hsa-miR-1253	CLIP-seq
MIRT1101177	hsa-miR-1912	CLIP-seq
MIRT1101178	hsa-miR-298	CLIP-seq
MIRT1101179	hsa-miR-3130-5p	CLIP-seq
MIRT1101181	hsa-miR-3667-3p	CLIP-seq
MIRT1101182	hsa-miR-4323	CLIP-seq
MIRT1101183	hsa-miR-4433	CLIP-seq
MIRT1101184	hsa-miR-4434	CLIP-seq
MIRT1101185	hsa-miR-4459	CLIP-seq
MIRT1101186	hsa-miR-4482	CLIP-seq
MIRT1101187	hsa-miR-4516	CLIP-seq
MIRT1101189	hsa-miR-4736	CLIP-seq
MIRT1101190	hsa-miR-4763-3p	CLIP-seq
MIRT1101191	hsa-miR-4768-3p	CLIP-seq
MIRT1101194	hsa-miR-4787-5p	CLIP-seq
MIRT1101196	hsa-miR-555	CLIP-seq
MIRT1101198	hsa-miR-642a	CLIP-seq
MIRT1101199	hsa-miR-922	CLIP-seq
MIRT1101175	hsa-miR-1207-5p	CLIP-seq
MIRT1101176	hsa-miR-1253	CLIP-seq
MIRT1101177	hsa-miR-1912	CLIP-seq
MIRT1101178	hsa-miR-298	CLIP-seq
MIRT1101179	hsa-miR-3130-5p	CLIP-seq
MIRT1101181	hsa-miR-3667-3p	CLIP-seq
MIRT1101182	hsa-miR-4323	CLIP-seq
MIRT1101183	hsa-miR-4433	CLIP-seq
MIRT1101184	hsa-miR-4434	CLIP-seq
MIRT1101185	hsa-miR-4459	CLIP-seq
MIRT1101186	hsa-miR-4482	CLIP-seq
MIRT1101187	hsa-miR-4516	CLIP-seq
MIRT1101189	hsa-miR-4736	CLIP-seq
MIRT1101190	hsa-miR-4763-3p	CLIP-seq
MIRT1101191	hsa-miR-4768-3p	CLIP-seq
MIRT1101194	hsa-miR-4787-5p	CLIP-seq
MIRT1101195	hsa-miR-513a-3p	CLIP-seq
MIRT1101196	hsa-miR-555	CLIP-seq
MIRT1101198	hsa-miR-642a	CLIP-seq
MIRT1101199	hsa-miR-922	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
ESR1	Activation	11026574
KLF4	Activation	10859317
SP1	Activation	10859317

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002009	Process	Morphogenesis of an epithelium	IBA
GO:0005198	Function	Structural molecule activity	IEA
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	2448790
GO:0005515	Function	Protein binding	IPI	15846844, 16000376, 16189514, 20080707, 25416956, 25910212, 26871637, 29892012, 31515488, 32296183, 32814053
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005882	Component	Intermediate filament	IEA
GO:0005882	Component	Intermediate filament	TAS	2448790
GO:0005886	Component	Plasma membrane	IDA	23377137
GO:0007219	Process	Notch signaling pathway	IEA
GO:0008307	Function	Structural constituent of muscle	IDA	16000376
GO:0016010	Component	Dystrophin-associated glycoprotein complex	IEA
GO:0016327	Component	Apicolateral plasma membrane	IEA
GO:0030018	Component	Z disc	IEA
GO:0030280	Function	Structural constituent of skin epidermis	IBA
GO:0030855	Process	Epithelial cell differentiation	IBA
GO:0042383	Component	Sarcolemma	IEA
GO:0043034	Component	Costamere	IDA	16000376
GO:0043627	Process	Response to estrogen	IEP	10037815
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045095	Component	Keratin filament	IBA
GO:0045109	Process	Intermediate filament organization	IBA
GO:0045214	Process	Sarcomere organization	IDA	16000376
GO:0060706	Process	Cell differentiation involved in embryonic placenta development	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0071944	Component	Cell periphery	IDA	19185580
GO:1990357	Component	Terminal web	IEA

MIM	HGNC	e!Ensembl
148020	6436	ENSG00000171345

Protein

UniProt ID

P08727

Protein name

Keratin, type I cytoskeletal 19 (Cytokeratin-19) (CK-19) (Keratin-19) (K19)

Protein function

Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.

PDB

8XTN , 8XTO , 8Y3S , 8ZUG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00038	Filament	79 → 390	Intermediate filament protein	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in a defined zone of basal keratinocytes in the deep outer root sheath of hair follicles. Also observed in sweat gland and mammary gland ductal and secretory cells, bile ducts, gastrointestinal tract, bladder urothelium, oral

Sequence

MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA
YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA
PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL

Sequence length

400

Interactions

View interactions

	KEGG		Reactome
	Estrogen signaling pathway Staphylococcus aureus infection		Keratinization Formation of the cornified envelope

KRT19 (keratin 19)