Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	387082
Gene name Gene Name - the full gene name approved by the HGNC.	Small ubiquitin like modifier 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SUMO4
Synonyms (NCBI Gene) Gene synonyms aliases	IDDM5, SMT3H4, SUMO-4, dJ281H8.4
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins` subcellular localization, stability, or activity. The protein described in this rec

Show/Hide all(50)

miRTarBase ID	miRNA	Experiments
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT1403356	hsa-miR-186	CLIP-seq
MIRT1403357	hsa-miR-2053	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT1403360	hsa-miR-28-3p	CLIP-seq
MIRT1403361	hsa-miR-3123	CLIP-seq
MIRT1403362	hsa-miR-3925-5p	CLIP-seq
MIRT1403363	hsa-miR-3976	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq
MIRT1403367	hsa-miR-548p	CLIP-seq
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT2120869	hsa-miR-4793-5p	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT2342879	hsa-miR-1299	CLIP-seq
MIRT2342880	hsa-miR-1323	CLIP-seq
MIRT1403356	hsa-miR-186	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT2342881	hsa-miR-2964a-5p	CLIP-seq
MIRT2342882	hsa-miR-3133	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT2342883	hsa-miR-4263	CLIP-seq
MIRT2342884	hsa-miR-4328	CLIP-seq
MIRT2342885	hsa-miR-4436b-5p	CLIP-seq
MIRT2342886	hsa-miR-4446-5p	CLIP-seq
MIRT2342887	hsa-miR-4461	CLIP-seq
MIRT2342888	hsa-miR-4705	CLIP-seq
MIRT2342889	hsa-miR-4735-5p	CLIP-seq
MIRT2342890	hsa-miR-4773	CLIP-seq
MIRT2342891	hsa-miR-4782-5p	CLIP-seq
MIRT2120869	hsa-miR-4793-5p	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq
MIRT2342892	hsa-miR-516b	CLIP-seq
MIRT2342893	hsa-miR-548o	CLIP-seq
MIRT2342894	hsa-miR-576-5p	CLIP-seq
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005634	Component	Nucleus	IBA	21873635
GO:0016925	Process	Protein sumoylation	IBA	21873635
GO:0016925	Process	Protein sumoylation	IDA	15247916, 16236267, 18708028
GO:0031386	Function	Protein tag	IBA	21873635
GO:0034599	Process	Cellular response to oxidative stress	IDA	16236267, 18708028
GO:0043122	Process	Regulation of I-kappaB kinase/NF-kappaB signaling	IDA	15247916, 18708028
GO:0043388	Process	Positive regulation of DNA binding	IDA	16236267
GO:0043392	Process	Negative regulation of DNA binding	IDA	16236267
GO:0044389	Function	Ubiquitin-like protein ligase binding	IBA	21873635
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	15247916, 16236267
GO:0106068	Component	SUMO ligase complex	IDA	16236267
GO:1900180	Process	Regulation of protein localization to nucleus	IDA	16236267

MIM	HGNC	e!Ensembl
608829	21181	ENSG00000177688

Protein

UniProt ID

Q6EEV6

Protein name

Small ubiquitin-related modifier 4 (SUMO-4) (Small ubiquitin-like protein 4)

Protein function

Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11976	Rad60-SLD	18 → 88	Ubiquitin-2 like Rad60 SUMO-like	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen. {ECO:0000269|PubMed:15123604, ECO:0000269|PubMed:15247916}.

Sequence

MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRF
RFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY

Sequence length

Interactions

View interactions

	KEGG
	Nucleocytoplasmic transport Fluid shear stress and atherosclerosis

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Diabetes mellitus	DIABETES MELLITUS, INSULIN-DEPENDENT, 5	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining
Amyotrophic Lateral Sclerosis	Associate	35503374
Arthritis Rheumatoid	Associate	11145035
Autoimmune Diseases	Associate	11145035, 16249223, 19956095
Carcinoma Hepatocellular	Associate	15123604
Craniocerebral Trauma	Associate	35503374
Diabetes Mellitus Type 1	Associate	10762555, 11145035, 11204251, 15123604, 19956095
Disease Progression	Associate	35503374
Hypoxia	Stimulate	28545138
Neoplasms	Associate	35503374
Uveomeningoencephalitic Syndrome	Associate	19122825

SUMO4 (small ubiquitin like modifier 4)