SUMO4 (small ubiquitin like modifier 4)

Gene

• Entrez ID: 387082
• Gene name: Small ubiquitin like modifier 4
• Gene symbol: SUMO4
• Synonyms (NCBI Gene): IDDM5, SMT3H4, SUMO-4, dJ281H8.4
• Chromosome: 6
• Chromosome location: 6q25.1
• Summary: This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins` subcellular localization, stability, or activity. The protein described in this rec

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT1403356	hsa-miR-186	CLIP-seq
MIRT1403357	hsa-miR-2053	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT1403360	hsa-miR-28-3p	CLIP-seq
MIRT1403361	hsa-miR-3123	CLIP-seq
MIRT1403362	hsa-miR-3925-5p	CLIP-seq
MIRT1403363	hsa-miR-3976	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq
MIRT1403367	hsa-miR-548p	CLIP-seq
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT2120869	hsa-miR-4793-5p	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT2342879	hsa-miR-1299	CLIP-seq
MIRT2342880	hsa-miR-1323	CLIP-seq
MIRT1403356	hsa-miR-186	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT2342881	hsa-miR-2964a-5p	CLIP-seq
MIRT2342882	hsa-miR-3133	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT2342883	hsa-miR-4263	CLIP-seq
MIRT2342884	hsa-miR-4328	CLIP-seq
MIRT2342885	hsa-miR-4436b-5p	CLIP-seq
MIRT2342886	hsa-miR-4446-5p	CLIP-seq
MIRT2342887	hsa-miR-4461	CLIP-seq
MIRT2342888	hsa-miR-4705	CLIP-seq
MIRT2342889	hsa-miR-4735-5p	CLIP-seq
MIRT2342890	hsa-miR-4773	CLIP-seq
MIRT2342891	hsa-miR-4782-5p	CLIP-seq
MIRT2120869	hsa-miR-4793-5p	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq
MIRT2342892	hsa-miR-516b	CLIP-seq
MIRT2342893	hsa-miR-548o	CLIP-seq
MIRT2342894	hsa-miR-576-5p	CLIP-seq
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IBA
GO:0016925	Process	Protein sumoylation	IBA
GO:0016925	Process	Protein sumoylation	IDA	15247916, 16236267, 18708028
GO:0016925	Process	Protein sumoylation	IEA
GO:0031386	Function	Protein tag activity	IBA
GO:0034599	Process	Cellular response to oxidative stress	IDA	16236267, 18708028
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IDA	15247916, 18708028
GO:0043388	Process	Positive regulation of DNA binding	IDA	16236267
GO:0043392	Process	Negative regulation of DNA binding	IDA	16236267
GO:0044389	Function	Ubiquitin-like protein ligase binding	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15247916, 16236267
GO:0106068	Component	SUMO ligase complex	IDA	16236267
GO:1900180	Process	Regulation of protein localization to nucleus	IDA	16236267
GO:1900180	Process	Regulation of protein localization to nucleus	IEA

Other IDs

• MIM: 608829
• HGNC: 21181
• e!Ensembl: ENSG00000177688

Protein

• UniProt ID: Q6EEV6
• Protein name: Small ubiquitin-related modifier 4 (SUMO-4) (Small ubiquitin-like protein 4)
• Protein function: Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugat
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11976	Rad60-SLD	18 → 88	Ubiquitin-2 like Rad60 SUMO-like	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen. {ECO:0000269|PubMed:15123604, ECO:0000269|PubMed:15247916}.
• Sequence:

  MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRF
  RFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY

• Sequence length: 95

Pathways

KEGG:

Nucleocytoplasmic transport
Fluid shear stress and atherosclerosis

<