Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
387032
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger with KRAB and SCAN domains 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZKSCAN4
Synonyms (NCBI Gene) Gene synonyms aliases
P1P373C6, ZNF307, ZNF427, ZSCAN36
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT692276 hsa-miR-595 HITS-CLIP 23313552
MIRT641773 hsa-miR-8485 HITS-CLIP 23313552
MIRT651261 hsa-miR-329-3p HITS-CLIP 23313552
MIRT651260 hsa-miR-362-3p HITS-CLIP 23313552
MIRT651259 hsa-miR-603 HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 26871637, 28514442, 31403225, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611643 13854 ENSG00000187626
Protein
UniProt ID Q969J2
Protein name Zinc finger protein with KRAB and SCAN domains 4 (P373c6.1) (Zinc finger protein 307) (Zinc finger protein 427)
Protein function May be involved in the transcriptional activation of MDM2 and EP300 genes.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 49 138 SCAN domain Domain
PF01352 KRAB 220 260 KRAB box Family
PF00096 zf-C2H2 320 342 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 348 370 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 376 398 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 404 426 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 432 454 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 487 509 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 515 537 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in adult heart, brain, placenta, lung and kidney, but not in adult liver and skeletal muscle. In 17-day old embryo, detected in liver, skeletal muscle, brain, heart and small intestine. {ECO:0000269|PubMed:17910948}.
Sequence
MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSPARGPERSRQRFRGFR
YPEAAGPREALSRLRELCGQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPES
GEEVVVLLEYLERQLDEP
APQVPVGDQGQELLCCKMALLTQTQGSQSSQCQPMKALFKHE
SLGSQPLHDRVLQVPGLAQGGCCREDAMVASRLTPGSQGLLKMEDVALTLTPGWTQLDSS
QVNLYRDEKQENHSSLVSLG
GEIQTKSRDLPPVKKLPEKEHGKICHLREDIAQIPTHAEA
GEQEGRLQRKQKNAIGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIGS
SALVIHQRVH
TGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSLL
EHHKIH
TGEKPYQCNMCGKAFRRNSHLLRHQRIHGDKNVQNPEHGESWESQGRTESQWEN
TEAPVSYKCNECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGK
KTLSQ
Sequence length 545
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Lung adenocarcinoma Familial squamous cell lung carcinoma N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 27898717
Metabolic Syndrome Associate 37138862
Osteoarthritis Associate 37138862