Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3866
Gene name Gene Name - the full gene name approved by the HGNC.	Keratin 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KRT15
Synonyms (NCBI Gene) Gene synonyms aliases	CK15, K15, K1CO
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type

Show/Hide all(41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043849	hsa-miR-340-3p	CLASH	23622248
MIRT1101143	hsa-miR-3941	CLIP-seq
MIRT1101144	hsa-miR-466	CLIP-seq
MIRT1101145	hsa-miR-4672	CLIP-seq
MIRT1101146	hsa-miR-4731-3p	CLIP-seq
MIRT1101147	hsa-miR-4801	CLIP-seq
MIRT1101148	hsa-miR-502-5p	CLIP-seq
MIRT1101149	hsa-miR-556-5p	CLIP-seq
MIRT1101148	hsa-miR-502-5p	CLIP-seq
MIRT2258835	hsa-miR-1207-5p	CLIP-seq
MIRT2258836	hsa-miR-3150a-3p	CLIP-seq
MIRT2258837	hsa-miR-3175	CLIP-seq
MIRT2258838	hsa-miR-3199	CLIP-seq
MIRT2258839	hsa-miR-3714	CLIP-seq
MIRT2258840	hsa-miR-3921	CLIP-seq
MIRT1101143	hsa-miR-3941	CLIP-seq
MIRT2258841	hsa-miR-4481	CLIP-seq
MIRT2258842	hsa-miR-4493	CLIP-seq
MIRT2258843	hsa-miR-4502	CLIP-seq
MIRT2258844	hsa-miR-4653-5p	CLIP-seq
MIRT1101144	hsa-miR-466	CLIP-seq
MIRT1101145	hsa-miR-4672	CLIP-seq
MIRT2258845	hsa-miR-4693-3p	CLIP-seq
MIRT2258846	hsa-miR-4712-3p	CLIP-seq
MIRT1101146	hsa-miR-4731-3p	CLIP-seq
MIRT2258847	hsa-miR-4745-5p	CLIP-seq
MIRT2258848	hsa-miR-4763-3p	CLIP-seq
MIRT1101147	hsa-miR-4801	CLIP-seq
MIRT2258849	hsa-miR-491-5p	CLIP-seq
MIRT1101148	hsa-miR-502-5p	CLIP-seq
MIRT1101149	hsa-miR-556-5p	CLIP-seq
MIRT2258850	hsa-miR-939	CLIP-seq
MIRT2258851	hsa-miR-940	CLIP-seq
MIRT2258835	hsa-miR-1207-5p	CLIP-seq
MIRT2258838	hsa-miR-3199	CLIP-seq
MIRT2258839	hsa-miR-3714	CLIP-seq
MIRT2258842	hsa-miR-4493	CLIP-seq
MIRT2390031	hsa-miR-4515	CLIP-seq
MIRT2390032	hsa-miR-4653-3p	CLIP-seq
MIRT2258848	hsa-miR-4763-3p	CLIP-seq
MIRT2258851	hsa-miR-940	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
FOXM1	Unknown	22761689

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	2580298
GO:0005515	Function	Protein binding	IPI	16189514, 22458338, 25416956, 25910212, 26871637, 27812135, 29892012, 31515488, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0008544	Process	Epidermis development	TAS	2452170
GO:0031424	Process	Keratinization	TAS
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070268	Process	Cornification	TAS
GO:0097110	Function	Scaffold protein binding	IPI	10852826

MIM	HGNC	e!Ensembl
148030	6421	ENSG00000171346

Protein

UniProt ID

P19012

Protein name

Keratin, type I cytoskeletal 15 (Cytokeratin-15) (CK-15) (Keratin-15) (K15)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00038	Filament	104 → 416	Intermediate filament protein	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in a discontinuous manner in the basal cell layer of adult skin epidermis, but continuously in the basal layer of fetal skin epidermis and nail. Also expressed in the outer root sheath above the hair bulb in hair follicle (at

Sequence

MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSARFVSSGSGGGY
GGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEKITMQNLNDRLASYL
DKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILE
IDNARLAADDFRLKYENELALRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYL
KKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSK
TEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQ
LQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGI
AIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI

Sequence length

456

Interactions

View interactions

	KEGG		Reactome
	Estrogen signaling pathway Staphylococcus aureus infection		Keratinization Formation of the cornified envelope

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Adenocarcinoma	Adenoid Cystic Carcinoma	rs121913530, rs886039394, rs121913474	16762588

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	23869193, 31809668, 35328735
Barrett Esophagus	Associate	35328735
Breast Neoplasms	Associate	19383306, 21574054
Carcinoma Basal Cell	Associate	29135512
Carcinoma Hepatocellular	Associate	28258914
Carcinoma Non Small Cell Lung	Associate	23869193
Carcinoma Renal Cell	Associate	36858509
Carcinoma Squamous Cell	Associate	12946229, 31809668
Cardiotoxicity	Associate	29247589
Castleman Disease	Associate	11752170
Cysts	Associate	11564167
Diabetes Mellitus	Associate	21866211, 24255036, 25446319, 26788028
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	25760270
Dyskinesias	Associate	25760270
Dysplastic Nevus Syndrome	Associate	25760270
Endometrial Neoplasms	Associate	35866777
Epidermolysis Bullosa Dystrophica	Associate	35304249
Esophageal Neoplasms	Associate	27797221
Esophageal Squamous Cell Carcinoma	Associate	27797221
Giant Cell Arteritis	Associate	11876765
Hodgkin Disease	Associate	25948739
Inflammation	Stimulate	20534855
Inflammation	Associate	29950425
Keratosis Actinic	Associate	20852595
Lichen Planus	Associate	28155975
Lymphoma Primary Effusion	Associate	11752170, 25948739
Lymphomatoid Papulosis	Associate	20852595
Melanoma	Associate	32934956, 33441834
Melanoma Cutaneous Malignant	Associate	32934956
Microcystic adnexal carcinoma	Associate	18065959
Multi centric Castleman's Disease	Associate	18000163, 25187543
Neoplasm Invasiveness	Associate	19383306
Neoplasm Metastasis	Associate	35866777
Neoplasms	Associate	16906285, 19383306, 21574054, 22073364, 25948739, 27797221, 27959387, 35866777, 8932346
Neoplasms Glandular and Epithelial	Associate	20852595
Nevus	Associate	32934956
Nevus Pigmented	Associate	32934956
Pelvic Inflammatory Disease	Associate	20190734, 23398472
Polymyalgia Rheumatica	Associate	11876765
Sarcoma Kaposi	Associate	25948739, 28938025, 29795033
Trichilemmal Cyst 1	Inhibit	17091763
Trichoepitheliomas Multiple Desmoplastic	Associate	18065959, 23398472
Urinary Bladder Neoplasms	Associate	12778082
Uterine Cervicitis	Stimulate	35866777

KRT15 (keratin 15)