KLRC2 (killer cell lectin like receptor C2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3822
Gene name Gene Name - the full gene name approved by the HGNC.
Killer cell lectin like receptor C2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLRC2
Synonyms (NCBI Gene) Gene synonyms aliases
CD159c, NKG2-C, NKG2C
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(27)
miRTarBase ID miRNA Experiments Reference
MIRT017833 hsa-miR-335-5p Microarray 18185580
MIRT029433 hsa-miR-26b-5p Microarray 19088304
MIRT1099200 hsa-miR-125a-5p CLIP-seq
MIRT1099201 hsa-miR-125b CLIP-seq
MIRT1099202 hsa-miR-1305 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IDA 9655483
GO:0002228 Process Natural killer cell mediated immunity IDA 18448674
GO:0004888 Function Transmembrane signaling receptor activity TAS 9683661
GO:0005515 Function Protein binding IPI 9655483, 18448674
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602891 6375 ENSG00000205809
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P26717
Protein name NKG2-C type II integral membrane protein (CD159 antigen-like family member C) (NK cell receptor C) (NKG2-C-activating NK receptor) (CD antigen CD159c)
Protein function Immune activating receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from n
PDB 2L35
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 134 → 229 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in NK cell subsets, in particular in adaptive CD57-positive NK cells (at protein level) (PubMed:20952657, PubMed:21825173). Expressed in terminally differentiated cytotoxic gamma-delta T cells (at protein level) (PubMed:20952
Sequence 
MSKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYD
CQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNTRTQKARHCGHCPEE
WITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSS
HHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
Sequence length 231
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Antigen processing and presentation
Natural killer cell mediated cytotoxicity 		  DAP12 interactions
DAP12 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Creutzfeldt-jakob disease New Variant Creutzfeldt-Jakob Disease, Creutzfeldt-Jakob Disease, Familial rs193922906, rs74315401, rs28933385, rs74315412, rs398122370 23349890
Show/Hide Text Mining Associations (62)
Associations from Text Mining
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 37426645
Acquired Immunodeficiency Syndrome Associate 17035308
AIDS related Kaposi sarcoma Associate 17035308
Alopecia Areata Associate 18160967
Anthropophobia Associate 34076484
Autism Spectrum Disorder Associate 31123562, 37352688
Behcet Syndrome Associate 23336215
Breast Neoplasms Associate 37081323
Carcinoma Hepatocellular Associate 37501379
Carcinoma Renal Cell Associate 37919459