Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3821
Gene name Gene Name - the full gene name approved by the HGNC.
Killer cell lectin like receptor C1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLRC1
Synonyms (NCBI Gene) Gene synonyms aliases
CD159A, NKG2, NKG2A
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016715 hsa-miR-335-5p Microarray 18185580
MIRT019278 hsa-miR-148b-3p Microarray 17612493
MIRT021318 hsa-miR-9-5p Microarray 17612493
MIRT028761 hsa-miR-26b-5p Microarray 19088304
MIRT1099191 hsa-miR-1305 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001915 Process Negative regulation of T cell mediated cytotoxicity IBA
GO:0001915 Process Negative regulation of T cell mediated cytotoxicity IDA 9485206
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IBA
GO:0002250 Process Adaptive immune response IEA
GO:0002305 Process CD8-positive, gamma-delta intraepithelial T cell differentiation IDA 18064301
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
161555 6374 ENSG00000134545
Protein
UniProt ID P26715
Protein name NKG2-A/NKG2-B type II integral membrane protein (CD159 antigen-like family member A) (NK cell receptor A) (NKG2-A/B-activating NK receptor) (CD antigen CD159a)
Protein function Immune inhibitory receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic and regulatory lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides d
PDB 2RMX , 2YU7 , 3BDW , 3CDG , 3CII
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 136 231 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in NK cells (at protein level) (PubMed:20952657, PubMed:9430220, PubMed:9485206). Expressed in intraepithelial CD8-positive T cell subsets with higher frequency in gamma-delta T cells than alpha-beta T cells (at
Sequence
MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYH
CKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCP
EEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRN
SSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH
KL
Sequence length 233
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 21806677
Adenocarcinoma of Lung Associate 34745015
Adenomyosis Associate 36828189
Angina Pectoris Inhibit 26823790
Antiphospholipid Syndrome Associate 33103514
Arthritis Rheumatoid Associate 22102879, 24673109, 27783394
Asthma Associate 35606283
Behcet Syndrome Associate 30319620
Breast Neoplasms Associate 25217158
Bronchiolitis Obliterans Syndrome Associate 34183227