KLRC1 (killer cell lectin like receptor C1)

Gene

• Entrez ID: 3821
• Gene name: Killer cell lectin like receptor C1
• Gene symbol: KLRC1
• Synonyms (NCBI Gene): CD159A, NKG2, NKG2A
• Chromosome: 12
• Chromosome location: 12p13.2
• Summary: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016715	hsa-miR-335-5p	Microarray	18185580
MIRT019278	hsa-miR-148b-3p	Microarray	17612493
MIRT021318	hsa-miR-9-5p	Microarray	17612493
MIRT028761	hsa-miR-26b-5p	Microarray	19088304
MIRT1099191	hsa-miR-1305	CLIP-seq
MIRT1099192	hsa-miR-3929	CLIP-seq
MIRT1099193	hsa-miR-4419b	CLIP-seq
MIRT1099194	hsa-miR-4469	CLIP-seq
MIRT1099195	hsa-miR-4478	CLIP-seq
MIRT1099196	hsa-miR-4714-3p	CLIP-seq
MIRT1099197	hsa-miR-4719	CLIP-seq
MIRT1099198	hsa-miR-548aa	CLIP-seq
MIRT1099199	hsa-miR-570	CLIP-seq
MIRT1099191	hsa-miR-1305	CLIP-seq
MIRT1099196	hsa-miR-4714-3p	CLIP-seq
MIRT2683639	hsa-miR-3120-5p	CLIP-seq
MIRT2683640	hsa-miR-4652-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001915	Process	Negative regulation of T cell mediated cytotoxicity	IBA
GO:0001915	Process	Negative regulation of T cell mediated cytotoxicity	IDA	9485206
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002305	Process	CD8-positive, gamma-delta intraepithelial T cell differentiation	IDA	18064301
GO:0002376	Process	Immune system process	IEA
GO:0002768	Process	Immune response-regulating cell surface receptor signaling pathway	IEA
GO:0002769	Process	Natural killer cell inhibitory signaling pathway	IDA	9485206
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	2007850
GO:0005515	Function	Protein binding	IPI	9485206, 18083576, 18448674, 25416956, 32296183, 32575403, 32814053
GO:0005886	Component	Plasma membrane	IDA	9485206, 9486650, 18064301, 18448674
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2007850
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	2007850
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0023024	Function	MHC class I protein complex binding	IEA
GO:0023024	Function	MHC class I protein complex binding	IPI	18448674
GO:0030246	Function	Carbohydrate binding	IEA
GO:0032394	Function	MHC class Ib receptor activity	IEA
GO:0032814	Process	Regulation of natural killer cell activation	NAS	18448674
GO:0042269	Process	Regulation of natural killer cell mediated cytotoxicity	IEA
GO:0043235	Component	Receptor complex	IDA	18448674
GO:0043235	Component	Receptor complex	IEA
GO:0043235	Component	Receptor complex	IPI	18448674
GO:0045087	Process	Innate immune response	IEA
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IBA
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	9485206, 9486650
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IBA
GO:0062080	Function	Inhibitory MHC class Ib receptor activity	IDA	37264229
GO:0062082	Function	HLA-E specific inhibitory MHC class Ib receptor activity	IDA	9486650, 18064301
GO:1990405	Function	Protein antigen binding	IDA	18448674

Other IDs

• MIM: 161555
• HGNC: 6374
• e!Ensembl: ENSG00000134545

Protein

• UniProt ID: P26715
• Protein name: NKG2-A/NKG2-B type II integral membrane protein (CD159 antigen-like family member A) (NK cell receptor A) (NKG2-A/B-activating NK receptor) (CD antigen CD159a)
• Protein function: Immune inhibitory receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic and regulatory lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides d
• PDB: 2RMX, 2YU7, 3BDW, 3CDG, 3CII
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	136 → 231	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in NK cells (at protein level) (PubMed:20952657, PubMed:9430220, PubMed:9485206). Expressed in intraepithelial CD8-positive T cell subsets with higher frequency in gamma-delta T cells than alpha-beta T cells (at
• Sequence:

  MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYH
  CKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCP
  EEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRN
  SSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL

• Sequence length: 233

Pathways

KEGG:

Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell