KLRB1 (killer cell lectin like receptor B1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 3820
Gene name Killer cell lectin like receptor B1
Gene symbol KLRB1
Synonyms (NCBI Gene)
CD161CLEC5BNKRNKR-P1NKR-P1ANKRP1AhNKR-P1A
Chromosome 12
Chromosome location 12p13.31
Summary Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be in
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT016742 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (11)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity TAS 8077657
GO:0005515 Function Protein binding IPI 21572041
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane TAS 8077657
GO:0007166 Process Cell surface receptor signaling pathway TAS 8077657
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
602890 6373 ENSG00000111796
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12918
Protein name Killer cell lectin-like receptor subfamily B member 1 (C-type lectin domain family 5 member B) (HNKR-P1a) (NKR-P1A) (Natural killer cell surface protein P1A) (CD antigen CD161)
Protein function Plays an inhibitory role on natural killer (NK) cells cytotoxicity. Activation results in specific acid sphingomyelinase/SMPD1 stimulation with subsequent marked elevation of intracellular ceramide. Activation also leads to AKT1/PKB and RPS6KA1/
PDB 5MGR , 5MGS , 5MGT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 111 → 212 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in a subset of NK cells predominantly in intestinal epithelium and liver. Detected in peripheral blood T-cells and preferentially in adult T-cells with a memory antigenic phenotype. {ECO:0000269|PubMed:12100027, ECO:0000269|P
Sequence 
MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSV
SVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLA
DCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEI
RGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
Sequence length 225
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Malaria   Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell