KLRB1 (killer cell lectin like receptor B1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3820
Gene name Gene Name - the full gene name approved by the HGNC.
Killer cell lectin like receptor B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLRB1
Synonyms (NCBI Gene) Gene synonyms aliases
CD161, CLEC5B, NKR, NKR-P1, NKR-P1A, NKRP1A, hNKR-P1A
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be in
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT016742 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity TAS 8077657
GO:0005515 Function Protein binding IPI 21572041
GO:0005886 Component Plasma membrane TAS
GO:0007166 Process Cell surface receptor signaling pathway TAS 8077657
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602890 6373 ENSG00000111796
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q12918
Protein name Killer cell lectin-like receptor subfamily B member 1 (C-type lectin domain family 5 member B) (HNKR-P1a) (NKR-P1A) (Natural killer cell surface protein P1A) (CD antigen CD161)
Protein function Plays an inhibitory role on natural killer (NK) cells cytotoxicity. Activation results in specific acid sphingomyelinase/SMPD1 stimulation with subsequent marked elevation of intracellular ceramide. Activation also leads to AKT1/PKB and RPS6KA1/
PDB 5MGR , 5MGS , 5MGT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 111 → 212 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in a subset of NK cells predominantly in intestinal epithelium and liver. Detected in peripheral blood T-cells and preferentially in adult T-cells with a memory antigenic phenotype. {ECO:0000269|PubMed:12100027, ECO:0000269|P
Sequence 
MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSV
SVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLA
DCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEI
RGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
Sequence length 225
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Malaria   Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)		 17295095
Show/Hide Text Mining Associations (83)
Associations from Text Mining
Disease Name Relationship Type References
Acute Disease Inhibit 24391773
Angina Pectoris Inhibit 26823790
Arthralgia Stimulate 24223933
Arthritis Associate 20133607, 23355538, 23677517
Arthritis Juvenile Associate 21381000, 24470328
Arthritis Psoriatic Associate 31677365, 36450783
Arthritis Rheumatoid Associate 19904767, 22102879, 25960619, 26147876
Arthritis Rheumatoid Inhibit 24223933, 30611306
Asthma Associate 17386028
Atherosclerosis Associate 15731463