KIR3DL1 (killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 1)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3811
Gene name Gene Name - the full gene name approved by the HGNC.
Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KIR3DL1
Synonyms (NCBI Gene) Gene synonyms aliases
CD158E1, KIR, KIR2DL5B, KIR3DL1/S1, NKAT-3, NKAT3, NKB1, NKB1B
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.42
Summary Summary of gene provided in NCBI Entrez Gene.
Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
miRTarBase ID miRNA Experiments Reference
MIRT021728 hsa-miR-132-3p Microarray 17612493
MIRT2025562 hsa-miR-3150b-3p CLIP-seq
MIRT2025563 hsa-miR-4784 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
E2F1 Activation 18358829
YY1 Unknown 23328843
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding IDA 24052308
GO:0005515 Function Protein binding IPI 27455421, 27649529, 32296183
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane NAS 7716543, 8662091
GO:0006955 Process Immune response NAS 7716543, 8662091
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604946 6338 ENSG00000167633
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P43629
Protein name Killer cell immunoglobulin-like receptor 3DL1 (CD158 antigen-like family member E) (HLA-BW4-specific inhibitory NK cell receptor) (Natural killer-associated transcript 3) (NKAT-3) (p70 natural killer cell receptor clones CL-2/CL-11) (p70 NK receptor CL-2/
Protein function Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.
PDB 3VH8 , 3WUW , 5B38 , 5B39 , 5T6Z , 5T70 , 6V3J , 7K80 , 7K81 , 9BL2 , 9BL3 , 9BL4 , 9BL5 , 9BL6 , 9BL9 , 9BLA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 32 → 110 Immunoglobulin domain Domain
PF00047 ig 127 → 210 Immunoglobulin domain Domain
PF00047 ig 227 → 307 Immunoglobulin domain Domain
Sequence 
MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFML
YKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGN
HRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANF
SIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHS
PYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLL
HLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKT
PPTDTILYTELPNAKPRSKVVSCP
Sequence length 444
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Hirschsprung disease Hirschsprung Disease rs76262710, rs75996173, rs77316810, rs75076352, rs76534745, rs76764689, rs76449634, rs377767412, rs193922699, rs75030001, rs606231342, rs1553540620, rs759944122, rs1057519322, rs1057519323
View all (4 more)		 19196962
Show/Hide Text Mining Associations (67)
Associations from Text Mining
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 17496894, 21471235, 25330014, 30147699
Acquired Immunodeficiency Syndrome Inhibit 31511383
Andersen Syndrome Associate 16936001
Aortic Aneurysm Abdominal Inhibit 34943866
Arthritis Rheumatoid Associate 24673109
Autoimmune Diseases Associate 30421793, 32235781
Behcet Syndrome Associate 27708262, 31405953, 31849952
Bronchiolitis Obliterans Syndrome Associate 17462498
Carcinoma Basal Cell Stimulate 31103021
Carcinoma Hepatocellular Associate 34728722