KIR2DS4 (killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4 (gene/pseudogene))

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 3809
Gene name Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4 (gene/pseudogene)
Gene symbol KIR2DS4
Synonyms (NCBI Gene)
CD158IKIR-2DS4KIR1DKIR412KKA3NKAT-8NKAT8
Chromosome 19
Chromosome location 19q13.42
Summary Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
miRNA miRNA information provided by mirtarbase database.
7
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (7)
miRTarBase ID miRNA Experiments Reference
MIRT1095251 hsa-miR-1267 CLIP-seq
MIRT1095252 hsa-miR-1275 CLIP-seq
MIRT1095253 hsa-miR-138 CLIP-seq
MIRT1095254 hsa-miR-3147 CLIP-seq
MIRT1095255 hsa-miR-4425 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0005515 Function Protein binding IPI 19858347, 24018270, 27649529
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 7749980
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
604955 6336 ENSG00000221957
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P43632
Protein name Killer cell immunoglobulin-like receptor 2DS4 (CD158 antigen-like family member I) (Natural killer-associated transcript 8) (NKAT-8) (P58 natural killer cell receptor clones CL-39/CL-17) (p58 NK receptor CL-39/CL-17) (CD antigen CD158i)
Protein function Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
PDB 3H8N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 32 → 115 Immunoglobulin domain Domain
PF00047 ig 132 → 213 Immunoglobulin domain Domain
Sequence 
MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLL
HREGKFNNTLHLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDM
VIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGT
FQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Antigen processing and presentation
Natural killer cell mediated cytotoxicity 		  DAP12 interactions