KIR2DS4 (killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4 (gene/pseudogene))

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3809
Gene name Gene Name - the full gene name approved by the HGNC.
Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4 (gene/pseudogene)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KIR2DS4
Synonyms (NCBI Gene) Gene synonyms aliases
CD158I, KIR-2DS4, KIR1D, KIR412, KKA3, NKAT-8, NKAT8
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.42
Summary Summary of gene provided in NCBI Entrez Gene.
Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(7)
miRTarBase ID miRNA Experiments Reference
MIRT1095251 hsa-miR-1267 CLIP-seq
MIRT1095252 hsa-miR-1275 CLIP-seq
MIRT1095253 hsa-miR-138 CLIP-seq
MIRT1095254 hsa-miR-3147 CLIP-seq
MIRT1095255 hsa-miR-4425 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0005515 Function Protein binding IPI 19858347, 24018270, 27649529
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 7749980
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
604955 6336 ENSG00000221957
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID P43632
Protein name Killer cell immunoglobulin-like receptor 2DS4 (CD158 antigen-like family member I) (Natural killer-associated transcript 8) (NKAT-8) (P58 natural killer cell receptor clones CL-39/CL-17) (p58 NK receptor CL-39/CL-17) (CD antigen CD158i)
Protein function Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
PDB 3H8N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 32 → 115 Immunoglobulin domain Domain
PF00047 ig 132 → 213 Immunoglobulin domain Domain
Sequence 
MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLL
HREGKFNNTLHLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDM
VIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGT
FQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG   Reactome
  Antigen processing and presentation
Natural killer cell mediated cytotoxicity 		  DAP12 interactions
<