Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3777
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium two pore domain channel subfamily K member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNK3
Synonyms (NCBI Gene) Gene synonyms aliases
K2p3.1, OAT1, PPH4, TASK, TASK-1, TASK1, TBAK1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PPH4
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the superfamily of potassium channel proteins that contain two pore-forming P domains. The encoded protein is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs398123039 G>A Pathogenic Coding sequence variant, missense variant
rs398123040 G>A Pathogenic 5 prime UTR variant, coding sequence variant, missense variant
rs398123041 G>C Pathogenic Coding sequence variant, missense variant
rs398123042 G>A,C Likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs398123043 A>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT623516 hsa-miR-3691-3p HITS-CLIP 23824327
MIRT623515 hsa-miR-6814-5p HITS-CLIP 23824327
MIRT623514 hsa-miR-150-5p HITS-CLIP 23824327
MIRT623513 hsa-miR-6778-3p HITS-CLIP 23824327
MIRT623516 hsa-miR-3691-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005216 Function Ion channel activity IMP 12198146
GO:0005252 Function Open rectifier potassium channel activity IEA
GO:0005267 Function Potassium channel activity TAS 9312005
GO:0005886 Component Plasma membrane IMP 12198146
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603220 6278 ENSG00000171303
Protein
UniProt ID O14649
Protein name Potassium channel subfamily K member 3 (Acid-sensitive potassium channel protein TASK-1) (TWIK-related acid-sensitive K(+) channel 1) (Two pore potassium channel KT3.1) (Two pore K(+) channel KT3.1)
Protein function K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate
PDB 6RV2 , 6RV3 , 6RV4 , 9G9X
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07885 Ion_trans_2 59 134 Ion channel Family
PF07885 Ion_trans_2 165 248 Ion channel Family
Tissue specificity TISSUE SPECIFICITY: Widespread expression in adult. Strongest expression in pancreas and placenta. Lower expression in brain, lung, prostate, heart, kidney, uterus, small intestine and colon.
Sequence
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINT
LVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMT
MNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRR
CLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
Sequence length 394
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Aldosterone synthesis and secretion
Cortisol synthesis and secretion
Cushing syndrome
  TWIK-releated acid-sensitive K+ channel (TASK)
Phase 4 - resting membrane potential
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Hypertension Hypertensive disease rs13306026 30487518
Pulmonary arterial hypertension Familial pulmonary arterial hypertension, Pulmonary arterial hypertension, Idiopathic pulmonary arterial hypertension rs121909288, rs137852741, rs137852742, rs137852743, rs137852744, rs137852745, rs137852746, rs137852748, rs137852749, rs137852750, rs137852751, rs137852753, rs863223423, rs863223426, rs863223424
View all (116 more)
24951767, 23883380, 28388887
Pulmonary hypertension Idiopathic pulmonary hypertension, Familial primary pulmonary hypertension, PULMONARY HYPERTENSION, PRIMARY, 4, Pulmonary Hypertension, Primary, 1 rs5030847, rs5030850, rs753751183, rs121912592, rs121912593, rs121912596, rs121918359, rs137852741, rs137852742, rs137852743, rs137852744, rs137852745, rs137852746, rs137852747, rs137852748
View all (349 more)
28388887, 24951767, 23883380
Unknown
Disease term Disease name Evidence References Source
Ischemic stroke Ischemic stroke 29531354 ClinVar
Heritable Pulmonary Arterial Hypertension heritable pulmonary arterial hypertension GenCC
Pulmonary Hypertension pulmonary hypertension, primary, 4 GenCC
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Atrial Fibrillation Associate 39637865
Breast Neoplasms Associate 28252570
Carcinoma Basal Cell Associate 35011589
Carcinoma Squamous Cell Associate 35676660
Cardiovascular Diseases Associate 20665672
Channelopathies Associate 28388887, 30354297, 33036472
Chemical and Drug Induced Liver Injury Associate 19034961
Cholestasis Extrahepatic Associate 19034961
Developmental Disabilities Associate 36195757
Drug Related Side Effects and Adverse Reactions Associate 19034961