Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3772
Gene name Gene Name - the full gene name approved by the HGNC.	Potassium inwardly rectifying channel subfamily J member 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KCNJ15
Synonyms (NCBI Gene) Gene synonyms aliases	IRKK, KIR1.3, KIR4.2
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q22.13-q22.2
Summary Summary of gene provided in NCBI Entrez Gene.	Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has

Show/Hide all(80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021341	hsa-miR-9-5p	Microarray	17612493
MIRT027409	hsa-miR-98-5p	Microarray	19088304
MIRT687805	hsa-miR-548ac	HITS-CLIP	23313552
MIRT687804	hsa-miR-548bb-3p	HITS-CLIP	23313552
MIRT687803	hsa-miR-548d-3p	HITS-CLIP	23313552
MIRT687802	hsa-miR-548h-3p	HITS-CLIP	23313552
MIRT687801	hsa-miR-548z	HITS-CLIP	23313552
MIRT687800	hsa-miR-548ae-3p	HITS-CLIP	23313552
MIRT687799	hsa-miR-548ah-3p	HITS-CLIP	23313552
MIRT687798	hsa-miR-548aj-3p	HITS-CLIP	23313552
MIRT687797	hsa-miR-548am-3p	HITS-CLIP	23313552
MIRT687796	hsa-miR-548aq-3p	HITS-CLIP	23313552
MIRT687795	hsa-miR-548j-3p	HITS-CLIP	23313552
MIRT687794	hsa-miR-548x-3p	HITS-CLIP	23313552
MIRT687793	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT687792	hsa-miR-433-5p	HITS-CLIP	23313552
MIRT687791	hsa-miR-340-3p	HITS-CLIP	23313552
MIRT687790	hsa-miR-6827-3p	HITS-CLIP	23313552
MIRT687789	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT569800	hsa-miR-548ao-3p	PAR-CLIP	20371350
MIRT569799	hsa-miR-298	PAR-CLIP	20371350
MIRT569798	hsa-miR-498	PAR-CLIP	20371350
MIRT569800	hsa-miR-548ao-3p	PAR-CLIP	20371350
MIRT569799	hsa-miR-298	PAR-CLIP	20371350
MIRT569798	hsa-miR-498	PAR-CLIP	20371350
MIRT569800	hsa-miR-548ao-3p	PAR-CLIP	20371350
MIRT569799	hsa-miR-298	PAR-CLIP	20371350
MIRT569798	hsa-miR-498	PAR-CLIP	20371350
MIRT687805	hsa-miR-548ac	HITS-CLIP	23313552
MIRT687804	hsa-miR-548bb-3p	HITS-CLIP	23313552
MIRT687803	hsa-miR-548d-3p	HITS-CLIP	23313552
MIRT687802	hsa-miR-548h-3p	HITS-CLIP	23313552
MIRT687801	hsa-miR-548z	HITS-CLIP	23313552
MIRT687800	hsa-miR-548ae-3p	HITS-CLIP	23313552
MIRT687799	hsa-miR-548ah-3p	HITS-CLIP	23313552
MIRT687798	hsa-miR-548aj-3p	HITS-CLIP	23313552
MIRT687797	hsa-miR-548am-3p	HITS-CLIP	23313552
MIRT687796	hsa-miR-548aq-3p	HITS-CLIP	23313552
MIRT687795	hsa-miR-548j-3p	HITS-CLIP	23313552
MIRT687794	hsa-miR-548x-3p	HITS-CLIP	23313552
MIRT687793	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT687792	hsa-miR-433-5p	HITS-CLIP	23313552
MIRT687791	hsa-miR-340-3p	HITS-CLIP	23313552
MIRT687790	hsa-miR-6827-3p	HITS-CLIP	23313552
MIRT687789	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT569800	hsa-miR-548ao-3p	PAR-CLIP	20371350
MIRT569799	hsa-miR-298	PAR-CLIP	20371350
MIRT569798	hsa-miR-498	PAR-CLIP	20371350
MIRT569800	hsa-miR-548ao-3p	PAR-CLIP	20371350
MIRT569799	hsa-miR-298	PAR-CLIP	20371350
MIRT569798	hsa-miR-498	PAR-CLIP	20371350
MIRT569800	hsa-miR-548ao-3p	PAR-CLIP	20371350
MIRT569799	hsa-miR-298	PAR-CLIP	20371350
MIRT569798	hsa-miR-498	PAR-CLIP	20371350
MIRT1081431	hsa-miR-1	CLIP-seq
MIRT1081432	hsa-miR-1909	CLIP-seq
MIRT1081433	hsa-miR-206	CLIP-seq
MIRT1081434	hsa-miR-3673	CLIP-seq
MIRT1081435	hsa-miR-500a	CLIP-seq
MIRT1081436	hsa-miR-613	CLIP-seq
MIRT1922162	hsa-miR-3157-3p	CLIP-seq
MIRT1922163	hsa-miR-874	CLIP-seq
MIRT2020175	hsa-miR-2113	CLIP-seq
MIRT2020176	hsa-miR-218	CLIP-seq
MIRT2252002	hsa-miR-3190	CLIP-seq
MIRT2252003	hsa-miR-4261	CLIP-seq
MIRT2252004	hsa-miR-4491	CLIP-seq
MIRT2252005	hsa-miR-4657	CLIP-seq
MIRT2438097	hsa-miR-1264	CLIP-seq
MIRT2438098	hsa-miR-1302	CLIP-seq
MIRT2438099	hsa-miR-149	CLIP-seq
MIRT2438100	hsa-miR-3064-5p	CLIP-seq
MIRT2438101	hsa-miR-3607-3p	CLIP-seq
MIRT2438102	hsa-miR-3652	CLIP-seq
MIRT2438103	hsa-miR-3686	CLIP-seq
MIRT2438104	hsa-miR-4298	CLIP-seq
MIRT2438105	hsa-miR-4430	CLIP-seq
MIRT2438106	hsa-miR-4505	CLIP-seq
MIRT2438107	hsa-miR-4794	CLIP-seq
MIRT2438108	hsa-miR-580	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005242	Function	Inward rectifier potassium channel activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	9647694, 32296183
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	8995301
GO:0006813	Process	Potassium ion transport	TAS	8995301
GO:0034765	Process	Regulation of ion transmembrane transport	IBA	21873635
GO:1990573	Process	Potassium ion import across plasma membrane	IBA	21873635

MIM	HGNC	e!Ensembl
602106	6261	ENSG00000157551

Protein

UniProt ID

Q99712

Protein name

ATP-sensitive inward rectifier potassium channel 15 (Inward rectifier K(+) channel Kir1.3) (Inward rectifier K(+) channel Kir4.2) (Potassium channel, inwardly rectifying subfamily J member 15)

Protein function

Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potass

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01007	IRK	30 → 171	Inward rectifier potassium channel transmembrane domain	Domain
PF17655	IRK_C	178 → 350	Inward rectifier potassium channel C-terminal domain	Domain

Sequence

MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ
RERELRTLLLQQSNV

Sequence length

375

Interactions

View interactions

	KEGG		Reactome
	Gastric acid secretion		Activation of G protein gated Potassium channels Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	29432188
Diabetes Mellitus	Associate	20085713
Diabetes Mellitus Type 2	Associate	20085713
Down Syndrome	Associate	9037601
Hypoxia	Stimulate	35740973
Parkinson Disease	Associate	33802862, 40566643
Urinary Bladder Neoplasms	Associate	35480865

KCNJ15 (potassium inwardly rectifying channel subfamily J member 15)