Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3764
Gene name	Potassium inwardly rectifying channel subfamily J member 8
Gene symbol	KCNJ8
Synonyms (NCBI Gene)	KIR6.1uKATP-1
Chromosome	12
Chromosome location	12p12.1
Summary	Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, whi

277

Show/Hide all (277)

miRTarBase ID	miRNA	Experiments	Reference
MIRT536557	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536556	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT536555	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT536554	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT536553	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT536552	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT536551	hsa-miR-302e	PAR-CLIP	22012620
MIRT536550	hsa-miR-520b	PAR-CLIP	22012620
MIRT536549	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT536548	hsa-miR-520e	PAR-CLIP	22012620
MIRT536547	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT536546	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT536545	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT536544	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT536543	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT536542	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT536541	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT536540	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT536539	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT536538	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT536537	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT536536	hsa-miR-512-3p	PAR-CLIP	22012620
MIRT536535	hsa-miR-556-3p	PAR-CLIP	22012620
MIRT536557	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536556	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT536555	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT536554	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT536553	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT536552	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT536551	hsa-miR-302e	PAR-CLIP	22012620
MIRT536550	hsa-miR-520b	PAR-CLIP	22012620
MIRT536549	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT536548	hsa-miR-520e	PAR-CLIP	22012620
MIRT536547	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT536546	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT536545	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT536544	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT536543	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT536542	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT536541	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT536540	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT536539	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT536538	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT536537	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT536536	hsa-miR-512-3p	PAR-CLIP	22012620
MIRT536535	hsa-miR-556-3p	PAR-CLIP	22012620
MIRT1081594	hsa-miR-106a	CLIP-seq
MIRT1081595	hsa-miR-106b	CLIP-seq
MIRT1081596	hsa-miR-1197	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081599	hsa-miR-1273e	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081601	hsa-miR-17	CLIP-seq
MIRT1081602	hsa-miR-1910	CLIP-seq
MIRT1081603	hsa-miR-20a	CLIP-seq
MIRT1081604	hsa-miR-20b	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT1081606	hsa-miR-2681	CLIP-seq
MIRT1081607	hsa-miR-302a	CLIP-seq
MIRT1081608	hsa-miR-302b	CLIP-seq
MIRT1081609	hsa-miR-302c	CLIP-seq
MIRT1081610	hsa-miR-302d	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081612	hsa-miR-3128	CLIP-seq
MIRT1081613	hsa-miR-3130-5p	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT1081615	hsa-miR-3152-3p	CLIP-seq
MIRT1081616	hsa-miR-3154	CLIP-seq
MIRT1081617	hsa-miR-34a	CLIP-seq
MIRT1081618	hsa-miR-34c-5p	CLIP-seq
MIRT1081619	hsa-miR-3591-5p	CLIP-seq
MIRT1081620	hsa-miR-3646	CLIP-seq
MIRT1081621	hsa-miR-3650	CLIP-seq
MIRT1081622	hsa-miR-3662	CLIP-seq
MIRT1081623	hsa-miR-3668	CLIP-seq
MIRT1081624	hsa-miR-371b-3p	CLIP-seq
MIRT1081625	hsa-miR-372	CLIP-seq
MIRT1081626	hsa-miR-373	CLIP-seq
MIRT1081627	hsa-miR-3929	CLIP-seq
MIRT1081628	hsa-miR-4267	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081630	hsa-miR-4280	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081632	hsa-miR-4419b	CLIP-seq
MIRT1081633	hsa-miR-4434	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1081636	hsa-miR-4478	CLIP-seq
MIRT1081637	hsa-miR-4482	CLIP-seq
MIRT1081638	hsa-miR-449a	CLIP-seq
MIRT1081639	hsa-miR-449b	CLIP-seq
MIRT1081640	hsa-miR-4516	CLIP-seq
MIRT1081641	hsa-miR-4517	CLIP-seq
MIRT1081642	hsa-miR-4720-5p	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1081644	hsa-miR-4729	CLIP-seq
MIRT1081645	hsa-miR-4768-3p	CLIP-seq
MIRT1081646	hsa-miR-4799-3p	CLIP-seq
MIRT1081647	hsa-miR-490-5p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT1081649	hsa-miR-519d	CLIP-seq
MIRT1081650	hsa-miR-622	CLIP-seq
MIRT1081651	hsa-miR-642b	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081653	hsa-miR-93	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1550410	hsa-miR-4728-3p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT2252042	hsa-miR-3074-3p	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT2252043	hsa-miR-34c-3p	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT2252044	hsa-miR-4666-5p	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1550410	hsa-miR-4728-3p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT2252045	hsa-miR-494	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT2252042	hsa-miR-3074-3p	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT2252043	hsa-miR-34c-3p	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT2252044	hsa-miR-4666-5p	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT2555393	hsa-miR-105	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT2555394	hsa-miR-129-5p	CLIP-seq
MIRT1081602	hsa-miR-1910	CLIP-seq
MIRT2555395	hsa-miR-1913	CLIP-seq
MIRT2555396	hsa-miR-198	CLIP-seq
MIRT2555397	hsa-miR-205	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT1081606	hsa-miR-2681	CLIP-seq
MIRT2555398	hsa-miR-3124-3p	CLIP-seq
MIRT1081613	hsa-miR-3130-5p	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT2555399	hsa-miR-3152-5p	CLIP-seq
MIRT2555400	hsa-miR-3155	CLIP-seq
MIRT2555401	hsa-miR-3155b	CLIP-seq
MIRT2555402	hsa-miR-3194-3p	CLIP-seq
MIRT2555403	hsa-miR-324-3p	CLIP-seq
MIRT2555404	hsa-miR-3545-3p	CLIP-seq
MIRT1081620	hsa-miR-3646	CLIP-seq
MIRT2555405	hsa-miR-3679-3p	CLIP-seq
MIRT2555406	hsa-miR-3685	CLIP-seq
MIRT1081627	hsa-miR-3929	CLIP-seq
MIRT1081628	hsa-miR-4267	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT2555407	hsa-miR-4328	CLIP-seq
MIRT1081632	hsa-miR-4419b	CLIP-seq
MIRT1081633	hsa-miR-4434	CLIP-seq
MIRT2555408	hsa-miR-4436b-5p	CLIP-seq
MIRT2555409	hsa-miR-4446-5p	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1081636	hsa-miR-4478	CLIP-seq
MIRT1081637	hsa-miR-4482	CLIP-seq
MIRT2555410	hsa-miR-4503	CLIP-seq
MIRT1081640	hsa-miR-4516	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1081645	hsa-miR-4768-3p	CLIP-seq
MIRT2555411	hsa-miR-4774-3p	CLIP-seq
MIRT2555412	hsa-miR-484	CLIP-seq
MIRT1081647	hsa-miR-490-5p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT2555413	hsa-miR-516a-3p	CLIP-seq
MIRT2555414	hsa-miR-520d-5p	CLIP-seq
MIRT2555415	hsa-miR-524-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT2555393	hsa-miR-105	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT2683233	hsa-miR-1273f	CLIP-seq
MIRT2555394	hsa-miR-129-5p	CLIP-seq
MIRT2683234	hsa-miR-143	CLIP-seq
MIRT1081602	hsa-miR-1910	CLIP-seq
MIRT2555395	hsa-miR-1913	CLIP-seq
MIRT2555396	hsa-miR-198	CLIP-seq
MIRT2555397	hsa-miR-205	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT1081606	hsa-miR-2681	CLIP-seq
MIRT2555398	hsa-miR-3124-3p	CLIP-seq
MIRT1081613	hsa-miR-3130-5p	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT2555399	hsa-miR-3152-5p	CLIP-seq
MIRT2555400	hsa-miR-3155	CLIP-seq
MIRT2555401	hsa-miR-3155b	CLIP-seq
MIRT2683235	hsa-miR-3171	CLIP-seq
MIRT2555402	hsa-miR-3194-3p	CLIP-seq
MIRT2555403	hsa-miR-324-3p	CLIP-seq
MIRT2555404	hsa-miR-3545-3p	CLIP-seq
MIRT2683236	hsa-miR-3619-3p	CLIP-seq
MIRT1081620	hsa-miR-3646	CLIP-seq
MIRT2555406	hsa-miR-3685	CLIP-seq
MIRT1081627	hsa-miR-3929	CLIP-seq
MIRT1081628	hsa-miR-4267	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT2555407	hsa-miR-4328	CLIP-seq
MIRT1081632	hsa-miR-4419b	CLIP-seq
MIRT1081633	hsa-miR-4434	CLIP-seq
MIRT2555408	hsa-miR-4436b-5p	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1081636	hsa-miR-4478	CLIP-seq
MIRT1081637	hsa-miR-4482	CLIP-seq
MIRT2555410	hsa-miR-4503	CLIP-seq
MIRT1081640	hsa-miR-4516	CLIP-seq
MIRT2683237	hsa-miR-4708-5p	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1081645	hsa-miR-4768-3p	CLIP-seq
MIRT2683238	hsa-miR-4770	CLIP-seq
MIRT2555411	hsa-miR-4774-3p	CLIP-seq
MIRT2683239	hsa-miR-4776-5p	CLIP-seq
MIRT2555412	hsa-miR-484	CLIP-seq
MIRT1081647	hsa-miR-490-5p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT2555413	hsa-miR-516a-3p	CLIP-seq
MIRT2555414	hsa-miR-520d-5p	CLIP-seq
MIRT2555415	hsa-miR-524-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq

Show/Hide all (95)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001774	Process	Microglial cell activation	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001944	Process	Vasculature development	IEA
GO:0002027	Process	Regulation of heart rate	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003007	Process	Heart morphogenesis	IEA
GO:0003229	Process	Ventricular cardiac muscle tissue development	IEA
GO:0005242	Function	Inward rectifier potassium channel activity	IEA
GO:0005242	Function	Inward rectifier potassium channel activity	TAS	7890693
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	TAS	7890693
GO:0006915	Process	Apoptotic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007507	Process	Heart development	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	TAS	7890693
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008282	Component	Inward rectifying potassium channel	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0009306	Process	Protein secretion	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010467	Process	Gene expression	IEA
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	IBA
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	IDA	20558321
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	IEA
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	IMP	21836131, 24700710
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	NAS	28842488
GO:0015908	Process	Fatty acid transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0017098	Function	Sulfonylurea receptor binding	IEA
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0019829	Function	ATPase-coupled monoatomic cation transmembrane transporter activity	IEA
GO:0019829	Function	ATPase-coupled monoatomic cation transmembrane transporter activity	ISS
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0030016	Component	Myofibril	IEA
GO:0031004	Component	Potassium ion-transporting ATPase complex	ISS
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033198	Process	Response to ATP	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034765	Process	Regulation of monoatomic ion transmembrane transport	IBA
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0038066	Process	P38MAPK cascade	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0043330	Process	Response to exogenous dsRNA	IEA
GO:0044546	Process	NLRP3 inflammasome complex assembly	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048787	Component	Presynaptic active zone membrane	IEA
GO:0050877	Process	Nervous system process	IEA
GO:0050905	Process	Neuromuscular process	IEA
GO:0051124	Process	Synaptic assembly at neuromuscular junction	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0060920	Process	Cardiac pacemaker cell differentiation	IEA
GO:0060922	Process	Atrioventricular node cell differentiation	IEA
GO:0060976	Process	Coronary vasculature development	IEA
GO:0061535	Process	Glutamate secretion, neurotransmission	IEA
GO:0061762	Process	CAMKK-AMPK signaling cascade	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	NAS	28842488
GO:0072359	Process	Circulatory system development	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098915	Process	Membrane repolarization during ventricular cardiac muscle cell action potential	IMP	20558321
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099505	Process	Regulation of presynaptic membrane potential	IEA
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IDA	18945825
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IEA
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IMP	18945825
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	NAS	18945825
GO:0150103	Process	Reactive gliosis	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1902282	Function	Voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization	IMP	20558321
GO:1904638	Process	Response to resveratrol	IEA
GO:1990573	Process	Potassium ion import across plasma membrane	IBA
GO:1990573	Process	Potassium ion import across plasma membrane	IDA	20558321
GO:1990573	Process	Potassium ion import across plasma membrane	IEA

MIM	HGNC	e!Ensembl
600935	6269	ENSG00000121361

Q15842

Protein name

ATP-sensitive inward rectifier potassium channel 8 (Inward rectifier K(+) channel Kir6.1) (Potassium channel, inwardly rectifying subfamily J member 8) (uKATP-1)

Protein function

Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it (PubMed:20558321, PubMed:21836131, PubMed:24700710, PubMed:28842488). Their voltage dependence is regulate

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01007	IRK	37 → 184	Inward rectifier potassium channel transmembrane domain	Domain
PF17655	IRK_C	191 → 363	Inward rectifier potassium channel C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly detected in fetal and adult heart. {ECO:0000269|PubMed:9573340}.

Sequence

MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSGLESTVC
VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK
TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV
VPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVV
ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE
KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQN
TSES

Sequence length

424

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway		ATP sensitive Potassium channels

276

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hypertrichotic osteochondrodysplasia Cantu type	Likely pathogenic	rs1366543712	RCV002287310

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Brugada syndrome	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	rs1940602689, rs768927826, rs1940616222, rs750317966, rs1940604697, rs369660507, rs2137051977, rs1162681542, rs751945188, rs752928813, rs368274950, rs1482460942, rs2137052056, rs747622709, rs556299317 View all (97 more)	RCV001315931 RCV001317600 RCV001319694 RCV001327454 RCV001340711 RCV001341106 RCV001443218 RCV001454632 RCV001480859 RCV001485035 RCV001501276 RCV001480273 RCV001924948 RCV001895850 RCV001990373 RCV001904238 RCV001964128 RCV001875650 RCV002050017 RCV001910317 RCV001916713 RCV000459771 RCV000474235 RCV001916945 RCV001986000 RCV002006660 RCV002018837 RCV001896671 RCV001965249 RCV001910925 RCV001990249 RCV001890448 RCV002081082 RCV002161158 RCV002145828 RCV002128563 RCV002108652 RCV002147866 RCV002179173 RCV001085300 RCV002295973 RCV000692088 RCV005096423 RCV003099702 RCV003539430 RCV005058510 RCV005097147 RCV003099837 RCV003539442 RCV003108083 RCV005058711 RCV000474015 RCV003083533 RCV002595612 RCV002651463 RCV002628555 RCV003115714 RCV002587111 RCV002583833 RCV002600626 RCV002725280 RCV002800099 RCV000197643 RCV003011317 RCV003028714 RCV003026768 RCV003057803 RCV003024984 RCV003054251 RCV003051570 RCV003062078 RCV000206018 RCV000204491 RCV001853306 RCV001432692 RCV001079136 RCV003540067 RCV003540060 RCV003539747 RCV003540082 RCV003540165 RCV003655595 RCV003655650 RCV003655706 RCV003654461 RCV003654632 RCV003654852 RCV003654897 RCV003818221 RCV003834816 RCV003881587 RCV005104493 RCV001080520 RCV001421979 RCV000467268 RCV005091052 RCV001472777 RCV000862777 RCV002064317 RCV003539982 RCV000862875 RCV001365713 RCV000638820 RCV000638796 RCV000638719 RCV000695089 RCV000704814 RCV000695087 RCV000818310 RCV000823161 RCV000808286 RCV003655327 RCV002064709 RCV001457325 RCV000932349 RCV001466796 RCV001858902 RCV001225347
Brugada syndrome 1	Uncertain significance	rs770087869	RCV000496355
Cardiac arrest	Uncertain significance	rs768851540	RCV000208382
Cardiac arrhythmia	Uncertain significance	rs730880120	RCV001842498
Cardiovascular phenotype	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	rs1940602689, rs750317966, rs751945188, rs752928813, rs368274950, rs556299317, rs763650307, rs34524779, rs34811413, rs142014286, rs1235054283, rs138391404, rs749697322, rs1940609307, rs770087869 View all (97 more)	RCV004034380 RCV004995684 RCV005369892 RCV006352314 RCV002388545 RCV002407205 RCV002361169 RCV000619579 RCV000619924 RCV002344160 RCV002389024 RCV002324296 RCV002370575 RCV004039164 RCV003164288 RCV002372992 RCV002454486 RCV002363701 RCV000621636 RCV002336343 RCV002357351 RCV002333684 RCV002445706 RCV002355983 RCV002366471 RCV002337868 RCV002361559 RCV002396293 RCV002416580 RCV002449680 RCV002385222 RCV002386969 RCV002369359 RCV002380501 RCV002447791 RCV002367154 RCV002396444 RCV002400522 RCV002412423 RCV002419428 RCV002447575 RCV002447625 RCV002414384 RCV002391798 RCV002387297 RCV002387445 RCV002385889 RCV002389657 RCV002403157 RCV002406340 RCV002394514 RCV002414903 RCV002408203 RCV002424369 RCV002429011 RCV002438028 RCV002453585 RCV005648240 RCV002408882 RCV003170941 RCV005362985 RCV000244148 RCV000621796 RCV002433916 RCV004125581 RCV002372239 RCV003182410 RCV003182411 RCV003182412 RCV003182413 RCV003182414 RCV003182415 RCV004263152 RCV000245470 RCV000251528 RCV003302120 RCV003293384 RCV003293385 RCV003302121 RCV003293386 RCV003358271 RCV003358272 RCV003368279 RCV003368280 RCV003339069 RCV003339070 RCV003339071 RCV003341701 RCV003341702 RCV005356467 RCV005587505 RCV004406236 RCV004519275 RCV004519276 RCV004519277 RCV004519278 RCV004519279 RCV004022344 RCV005365285 RCV000621500 RCV002393028 RCV003278845 RCV002395244 RCV000618777 RCV002377316 RCV005582356 RCV000619265 RCV000621922 RCV000620006 RCV002358801 RCV002440259 RCV002352154 RCV002369882 RCV002332718 RCV002416057 RCV002354674 RCV002372524 RCV002427451 RCV003353223
Cervical cancer	Benign	rs74069152	RCV005890895
Hypertrophic cardiomyopathy	Benign; Likely benign	rs72554071, rs765422464	RCV000852667 RCV000852668
KCNJ8-related disorder	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	rs750317966, rs138391404, rs72554071, rs117808169, rs139304559	RCV004758159 RCV003913439 RCV003927417 RCV005396507 RCV003922710
Long QT syndrome	Conflicting classifications of pathogenicity	rs117808169	RCV003318359
Ovarian serous cystadenocarcinoma	Benign	rs74069152	RCV005890896
SUDDEN INFANT DEATH SYNDROME	Benign; Likely benign	rs34811413, rs16924297	RCV000625194 RCV000625488
Sudden unexplained death	Uncertain significance	rs781083385	RCV005054305
Syndromic disease	Conflicting classifications of pathogenicity	rs117808169	RCV002272156
Thyroid cancer, nonmedullary, 1	Benign	rs74069152	RCV005890897

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Associate	22562657
Amyotrophic Lateral Sclerosis	Associate	29492846
Arrhythmias Cardiac	Associate	22562657
Atrial Fibrillation	Associate	22562657
Brugada Syndrome	Associate	20558321, 22056721, 22840528
Cantu syndrome	Associate	24176758, 24700710, 29327300, 31175705, 31828977, 32100467, 34056838, 37527933
Cardiomegaly	Associate	37527933
Cardiomyopathy Dilated	Associate	24339868
Cardiovascular Diseases	Associate	33686948
Carotid Stenosis	Associate	33686948
Cerebral Infarction	Associate	33686948
Constriction Pathologic	Associate	33259239
Death Sudden Cardiac	Associate	24176758
Developmental Disabilities	Associate	19139106
Diabetes Mellitus Transient Neonatal 1	Associate	19139106
Early Onset Glaucoma	Associate	20558321, 22056721
Epilepsy	Associate	19139106, 36097778
Esophageal Neoplasms	Associate	26631031
Glaucoma 1 Open Angle J	Associate	20558321, 22562657, 23632791, 24176758
Graft Occlusion Vascular	Associate	33259239
Heart Failure	Associate	37909603
Inflammation	Associate	37909603
Leiomyoma	Associate	18569028
Lymphedema	Associate	37527933
Nasopharyngeal Neoplasms	Associate	37538797
Neoplasms	Associate	26631031
Sarcopenia	Associate	37909603
Vascular Diseases	Associate	24176758
Ventricular Fibrillation	Associate	24176758

KCNJ8 (potassium inwardly rectifying channel subfamily J member 8)