Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	373156
Gene name	Glutathione S-transferase kappa 1
Gene symbol	GSTK1
Synonyms (NCBI Gene)	GSTGST 13-13GST13GST13-13GSTK1-1hGSTK1
Chromosome	7
Chromosome location	7q34
Summary	This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range o

Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022421	hsa-miR-124-3p	Microarray	18668037
MIRT048157	hsa-miR-196a-5p	CLASH	23622248
MIRT516744	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT516743	hsa-miR-1273f	PAR-CLIP	23446348
MIRT516742	hsa-miR-8069	PAR-CLIP	23446348
MIRT516741	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT516740	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT516739	hsa-miR-3170	PAR-CLIP	23446348
MIRT516738	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT516737	hsa-miR-5096	PAR-CLIP	23446348
MIRT516744	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT516743	hsa-miR-1273f	PAR-CLIP	23446348
MIRT516742	hsa-miR-8069	PAR-CLIP	23446348
MIRT516741	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT516740	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT516739	hsa-miR-3170	PAR-CLIP	23446348
MIRT516738	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT516737	hsa-miR-5096	PAR-CLIP	23446348
MIRT2543531	hsa-miR-1825	CLIP-seq
MIRT2543532	hsa-miR-1915	CLIP-seq
MIRT2543533	hsa-miR-2115	CLIP-seq
MIRT2543534	hsa-miR-3123	CLIP-seq
MIRT2543535	hsa-miR-3140-3p	CLIP-seq
MIRT2543536	hsa-miR-3165	CLIP-seq
MIRT2543537	hsa-miR-361-5p	CLIP-seq
MIRT2543538	hsa-miR-3918	CLIP-seq
MIRT2543539	hsa-miR-3925-5p	CLIP-seq
MIRT2543540	hsa-miR-3976	CLIP-seq
MIRT2543541	hsa-miR-3977	CLIP-seq
MIRT2543542	hsa-miR-4503	CLIP-seq
MIRT2543543	hsa-miR-4685-5p	CLIP-seq
MIRT2543544	hsa-miR-4691-5p	CLIP-seq
MIRT2543545	hsa-miR-4726-3p	CLIP-seq
MIRT2543546	hsa-miR-515-3p	CLIP-seq
MIRT2543547	hsa-miR-516a-3p	CLIP-seq
MIRT2543548	hsa-miR-519e	CLIP-seq
MIRT2543549	hsa-miR-539	CLIP-seq
MIRT2543550	hsa-miR-584	CLIP-seq
MIRT2543551	hsa-miR-875-5p	CLIP-seq
MIRT2682138	hsa-miR-1343	CLIP-seq
MIRT2543531	hsa-miR-1825	CLIP-seq
MIRT2543532	hsa-miR-1915	CLIP-seq
MIRT2543533	hsa-miR-2115	CLIP-seq
MIRT2682139	hsa-miR-3064-3p	CLIP-seq
MIRT2543534	hsa-miR-3123	CLIP-seq
MIRT2543535	hsa-miR-3140-3p	CLIP-seq
MIRT2543536	hsa-miR-3165	CLIP-seq
MIRT2543537	hsa-miR-361-5p	CLIP-seq
MIRT2543538	hsa-miR-3918	CLIP-seq
MIRT2543539	hsa-miR-3925-5p	CLIP-seq
MIRT2543540	hsa-miR-3976	CLIP-seq
MIRT2543541	hsa-miR-3977	CLIP-seq
MIRT2543542	hsa-miR-4503	CLIP-seq
MIRT2543543	hsa-miR-4685-5p	CLIP-seq
MIRT2682140	hsa-miR-4717-3p	CLIP-seq
MIRT2543545	hsa-miR-4726-3p	CLIP-seq
MIRT2543546	hsa-miR-515-3p	CLIP-seq
MIRT2543547	hsa-miR-516a-3p	CLIP-seq
MIRT2543548	hsa-miR-519e	CLIP-seq
MIRT2543549	hsa-miR-539	CLIP-seq
MIRT2543550	hsa-miR-584	CLIP-seq
MIRT2543551	hsa-miR-875-5p	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	14742434
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IBA
GO:0004602	Function	Glutathione peroxidase activity	IDA	14742434
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	19011089, 22583869, 25416956, 31515488, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005777	Component	Peroxisome	IBA
GO:0005777	Component	Peroxisome	IDA	14742434
GO:0005777	Component	Peroxisome	IEA
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
602321	16906	ENSG00000197448

Q9Y2Q3

Protein name

Glutathione S-transferase kappa 1 (EC 2.5.1.18) (GST 13-13) (GST class-kappa) (GSTK1-1) (hGSTK1) (Glutathione S-transferase subunit 13)

Protein function

Glutathione S-transferase that catalyzes the conjugation of glutathione to exogenous and endogenous compounds (PubMed:14709161, PubMed:14742434). Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-d

PDB

1YZX , 3RPN , 3RPP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01323	DSBA	7 → 211	DSBA-like thioredoxin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:14742434}.

Sequence

MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLP
RKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRE
LWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGA
FGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

Sequence length

226

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Metabolic pathways Peroxisome Chemical carcinogenesis - DNA adducts		Glutathione conjugation Peroxisomal protein import

GSTK1 (glutathione S-transferase kappa 1)