Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3706
Gene name Gene Name - the full gene name approved by the HGNC.	Inositol-trisphosphate 3-kinase A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ITPKA
Synonyms (NCBI Gene) Gene synonyms aliases	IP3-3KA, IP3KA
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q15.1
Summary Summary of gene provided in NCBI Entrez Gene.	Regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of the inositol 1,4,5-trisphosphate 3-kinase is responsible for regulating the levels of a large number of inositol

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016467	hsa-miR-193b-3p	Microarray	20304954
MIRT1074802	hsa-miR-1289	CLIP-seq
MIRT1074803	hsa-miR-129-3p	CLIP-seq
MIRT1074804	hsa-miR-3121-5p	CLIP-seq
MIRT1074805	hsa-miR-3127-3p	CLIP-seq
MIRT1074806	hsa-miR-3185	CLIP-seq
MIRT1074807	hsa-miR-4313	CLIP-seq
MIRT1074808	hsa-miR-4433	CLIP-seq
MIRT1074809	hsa-miR-4706	CLIP-seq
MIRT1074810	hsa-miR-4749-5p	CLIP-seq
MIRT1074802	hsa-miR-1289	CLIP-seq
MIRT1074808	hsa-miR-4433	CLIP-seq
MIRT1074809	hsa-miR-4706	CLIP-seq
MIRT1074810	hsa-miR-4749-5p	CLIP-seq
MIRT2389518	hsa-miR-146b-3p	CLIP-seq
MIRT2389519	hsa-miR-3130-3p	CLIP-seq
MIRT2389520	hsa-miR-3173-5p	CLIP-seq
MIRT2389521	hsa-miR-874	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IBA	21873635
GO:0004683	Function	Calmodulin-dependent protein kinase activity	IEA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006020	Process	Inositol metabolic process	IEA
GO:0006468	Process	Protein phosphorylation	IEA
GO:0007165	Process	Signal transduction	TAS	1847047, 2176078
GO:0008440	Function	Inositol-1,4,5-trisphosphate 3-kinase activity	IEA
GO:0016301	Function	Kinase activity	IBA	21873635
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0032958	Process	Inositol phosphate biosynthetic process	IBA	21873635
GO:0043197	Component	Dendritic spine	IEA
GO:0043647	Process	Inositol phosphate metabolic process	TAS
GO:0046854	Process	Phosphatidylinositol phosphorylation	IBA	21873635
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0061003	Process	Positive regulation of dendritic spine morphogenesis	IEA
GO:0097062	Process	Dendritic spine maintenance	IEA

MIM	HGNC	e!Ensembl
147521	6178	ENSG00000137825

Protein

UniProt ID

P23677

Protein name

Inositol-trisphosphate 3-kinase A (EC 2.7.1.127) (Inositol 1,4,5-trisphosphate 3-kinase A) (IP3 3-kinase A) (IP3K A) (InsP 3-kinase A)

Protein function

Catalyzes the phosphorylation of 1D-myo-inositol 1,4,5-trisphosphate (InsP3) into 1D-myo-inositol 1,3,4,5-tetrakisphosphate and participates to the regulation of calcium homeostasis. {ECO:0000269|PubMed:12747803, ECO:0000269|PubMed:15350214, ECO

PDB

1W2C , 1W2D , 1W2F , 4UPU , 8PP8 , 8PP9 , 8PPA , 8PPB , 8PPC , 8PPD , 8PPE , 8PPF , 8PPG , 8PPH , 8PPI , 8PPJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03770	IPK	245 → 456	Inositol polyphosphate kinase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain. {ECO:0000269|PubMed:1847047}.

Sequence

MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAK
RRGGQVPNGLPRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRL
STSSVSSTGSSSLLEDSEDDLLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVIS
PFKKRYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYCLARLMADALRGCVPAFHGVVER
DGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAP
TEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFE
EFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT
TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER

Sequence length

461

Interactions

View interactions

	KEGG		Reactome
	Inositol phosphate metabolism Metabolic pathways Calcium signaling pathway Phosphatidylinositol signaling system		Synthesis of IP3 and IP4 in the cytosol

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Asthma	Asthma, Childhood asthma	30929738	ClinVar, GWAS
Eczema	Eczema		GWAS
Coronary artery disease	Coronary artery disease		GWAS
Dermatitis	Dermatitis		GWAS

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	30352093
Adenocarcinoma of Lung	Associate	30352093, 32015686
Breast Neoplasms	Stimulate	33624455
Carcinoma Hepatocellular	Associate	26249031
Carcinoma Renal Cell	Associate	33221754, 37460577
Colitis Ulcerative	Stimulate	36857861
Endometrial Neoplasms	Associate	36805217
Heart Diseases	Associate	38003044
Lung Neoplasms	Associate	36688944, 37664985
Lymphatic Metastasis	Stimulate	33624455
Neoplasm Metastasis	Stimulate	37664985
Neoplasms	Associate	24564989, 26249031, 32015686, 33624455
Neoplasms	Stimulate	37664985
Wounds and Injuries	Associate	38003044

ITPKA (inositol-trisphosphate 3-kinase A)