Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	367
Gene name	Androgen receptor
Gene symbol	AR
Synonyms (NCBI Gene)	AISAR8DHTRHUMARAHYSP1KDNR3C4SBMASMAX1TFM
Chromosome	X
Chromosome location	Xq12
Summary	The androgen receptor gene is more than 90 kb long and codes for a protein that has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription fact

145

Show/Hide all (145)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1800053	C>A	Pathogenic, uncertain-significance, likely-benign	Coding sequence variant, missense variant, genic downstream transcript variant
rs9332969	G>A,T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs9332970	T>C	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs9332971	G>A,T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs104894742	G>A	Pathogenic	Coding sequence variant, 5 prime UTR variant, missense variant
rs112374098	C>A,T	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant, missense variant
rs137852562	C>T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852563	G>A	Pathogenic	Coding sequence variant, stop gained, genic downstream transcript variant
rs137852564	G>A,T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852565	G>A,C	Pathogenic	Coding sequence variant, stop gained, missense variant, genic downstream transcript variant
rs137852566	A>T	Pathogenic	Coding sequence variant, stop gained, missense variant
rs137852567	A>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852568	A>T	Pathogenic	Coding sequence variant, stop gained, genic downstream transcript variant
rs137852569	G>A	Pathogenic	Coding sequence variant, missense variant
rs137852570	A>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852571	G>A	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852572	G>A	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852573	G>A	Pathogenic, likely-pathogenic	Coding sequence variant, 3 prime UTR variant, missense variant
rs137852574	T>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852575	C>T	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant
rs137852576	G>A	Pathogenic	Coding sequence variant, 3 prime UTR variant, missense variant
rs137852577	C>T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852578	A>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852579	T>C	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852580	C>G,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852581	C>T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852582	A>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852583	G>A	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852584	G>A	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852585	T>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852586	G>A,T	Pathogenic	Coding sequence variant, intron variant, missense variant
rs137852587	T>A	Pathogenic	Coding sequence variant, intron variant, missense variant
rs137852588	C>T	Pathogenic	Coding sequence variant, intron variant, missense variant
rs137852589	G>A,T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852590	T>G	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant
rs137852591	C>G	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852592	T>C	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852593	G>A,C,T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852594	C>T	Pathogenic	Coding sequence variant, synonymous variant, genic downstream transcript variant
rs137852595	C>A,T	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852596	G>A	Pathogenic	Coding sequence variant, intron variant, missense variant
rs137852597	T>C	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852598	C>G,T	Pathogenic	Coding sequence variant, synonymous variant, missense variant, genic downstream transcript variant
rs137852599	A>C	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852600	G>A,T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs137852601	C>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs143040492	C>T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs201934623	C>T	Uncertain-significance, benign, pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs370215797	G>A	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs750324117	G>A,T	Pathogenic	Stop gained, missense variant, 5 prime UTR variant, coding sequence variant
rs754201976	G>A	Pathogenic	Missense variant, coding sequence variant, 3 prime UTR variant
rs754515125	C>A,G,T	Pathogenic	Intron variant, genic downstream transcript variant
rs755226547	A>G,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, genic downstream transcript variant
rs759327087	->A	Pathogenic	Frameshift variant, coding sequence variant, 5 prime UTR variant
rs766161615	C>G,T	Pathogenic	Synonymous variant, coding sequence variant, 5 prime UTR variant, stop gained
rs864622007	T>A	Likely-pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant
rs869320731	GC>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs869320732	AGGATGC>TTCGCCCCTGA	Pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs878853033	T>G	Pathogenic	Missense variant, 3 prime UTR variant, coding sequence variant
rs886039558	C>T	Pathogenic	Stop gained, genic downstream transcript variant, coding sequence variant
rs886041050	T>C	Likely-pathogenic	Intron variant, missense variant, coding sequence variant
rs886041128	C>T	Pathogenic	Stop gained, 3 prime UTR variant, coding sequence variant
rs886041129	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs886041130	G>A	Pathogenic	Splice acceptor variant, genic downstream transcript variant
rs886041131	T>-	Pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs886041132	C>T	Pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant
rs886041133	G>A,C	Likely-pathogenic, pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant
rs886041352	A>C	Pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant
rs925822435	A>C,G	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057518177	CCATTGAGCCAGGTGTAG>-	Pathogenic	Coding sequence variant, inframe deletion, genic downstream transcript variant
rs1057521121	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs1057521122	A>G	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057523747	G>A,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1064793480	G>A	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1064793645	G>-	Pathogenic	Frameshift variant, coding sequence variant, genic downstream transcript variant
rs1064794065	C>A	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1064794069	G>A	Pathogenic	Splice acceptor variant, genic downstream transcript variant
rs1064795250	C>A	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1085307685	A>G	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1085307962	C>T	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1131691625	T>A	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1131691681	T>A	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1131691710	->TGCC	Pathogenic	Frameshift variant, coding sequence variant, 5 prime UTR variant
rs1131691761	C>A	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant
rs1199988820	C>G,T	Pathogenic	5 prime UTR variant, missense variant, stop gained, coding sequence variant
rs1266872442	G>C	Likely-pathogenic	3 prime UTR variant, coding sequence variant, missense variant
rs1386577803	G>A	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs1481151440	C>A,T	Pathogenic	Synonymous variant, stop gained, 5 prime UTR variant, coding sequence variant
rs1555969382	->TGGGAAGGGTCTACCCTCGGCCGCCGTCCAAGACCTACCGAGGAGCTTTCCAGAATCTGTTCCAGAGCGTGCGCGAAGTGATCCAGAACCCGGGCCCCAGGCACCCAGAGGCCGCGAGC	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant, inframe indel
rs1555969512	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555969528	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555969545	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555969553	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555969670	->CCATT	Pathogenic	5 prime UTR variant, coding sequence variant, frameshift variant
rs1555969682	G>T	Pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs1555969684	->G	Pathogenic	5 prime UTR variant, coding sequence variant, frameshift variant
rs1555969694	->G	Pathogenic	5 prime UTR variant, coding sequence variant, frameshift variant
rs1555969807	C>A	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555970004	->C	Pathogenic	5 prime UTR variant, coding sequence variant, frameshift variant
rs1555970042	C>A	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555982860	G>A	Pathogenic	Intron variant, missense variant, coding sequence variant
rs1555982894	T>C	Pathogenic, likely-pathogenic	Intron variant, splice donor variant
rs1555990470	G>A	Likely-pathogenic	3 prime UTR variant, missense variant, coding sequence variant
rs1555990485	C>T	Pathogenic	3 prime UTR variant, missense variant, coding sequence variant
rs1555990488	T>C	Likely-pathogenic	3 prime UTR variant, missense variant, coding sequence variant
rs1555995750	C>-	Pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs1555995816	G>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555995822	G>A	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555995840	G>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555995842	C>A	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555995848	G>T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555995851	C>T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555995865	T>C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555995877	C>T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555996810	T>C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555996855	A>-	Pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs1555996863	G>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555996867	C>G	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555997580	C>T	Pathogenic	Genic downstream transcript variant, stop gained, coding sequence variant
rs1555997625	C>T	Uncertain-significance, pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555997626	T>C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555997799	AA>-	Pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs1555997810	G>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555998085	G>-	Pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs1555998102	ATG>-	Pathogenic	Genic downstream transcript variant, inframe deletion, coding sequence variant
rs1555998108	A>T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1555998114	TC>-	Pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs1569263557	GCAGC>TT	Pathogenic	Coding sequence variant, stop gained, inframe indel, 5 prime UTR variant
rs1569264288	->CCGCTGTGCGTCCCAC	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1569265331	CTCG>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1569265470	->G	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1569314508	G>C	Pathogenic	Splice donor variant, genic downstream transcript variant
rs1602143232	->TAG	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant
rs1602143677	->T	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1602144034	GGCGTTGGAG>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1602144278	T>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1602144428	GTCT>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1602144930	CT>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1602220874	TC>-	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs1602272308	A>T	Pathogenic	Coding sequence variant, stop gained, genic downstream transcript variant
rs1602272697	C>-	Pathogenic	Coding sequence variant, frameshift variant, genic downstream transcript variant
rs1602276233	G>A	Likely-pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs1602278831	G>T	Pathogenic	Genic downstream transcript variant, intron variant
rs1602279488	->A	Pathogenic	Coding sequence variant, frameshift variant, genic downstream transcript variant
rs1602280356	C>A,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant, genic downstream transcript variant

553

Show/Hide all (553)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003789	hsa-miR-488-5p	Luciferase reporter assayqRT-PCRWestern blot	21710544
MIRT003789	hsa-miR-488-5p	Luciferase reporter assayqRT-PCRWestern blot	21710544
MIRT006451	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	22386953
MIRT006451	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	22386953
MIRT003789	hsa-miR-488-5p	Luciferase reporter assayqRT-PCR	21710544
MIRT003789	hsa-miR-488-5p	Luciferase reporter assayqRT-PCR	21710544
MIRT006451	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	22386953
MIRT003789	hsa-miR-488-5p	Luciferase reporter assayqRT-PCR	21710544
MIRT003789	hsa-miR-488-5p	Luciferase reporter assayqRT-PCR	21710544
MIRT006451	hsa-miR-124-3p	Luciferase reporter assay	23069658
MIRT035517	hsa-miR-185-5p	Luciferase reporter assay	23417242
MIRT052016	hsa-let-7b-5p	CLASH	23622248
MIRT053223	hsa-miR-34a-5p	qRT-PCRWestern blot	23145211
MIRT054246	hsa-miR-205-5p	ImmunoprecipitationIn situ hybridizationLuciferase reporter assayMicorarrayQRTPCRWetsern blot	23571738
MIRT709810	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT709809	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT709808	hsa-miR-6818-5p	HITS-CLIP	19536157
MIRT709807	hsa-miR-147a	HITS-CLIP	19536157
MIRT709806	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT709805	hsa-miR-5010-3p	HITS-CLIP	19536157
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT515978	hsa-miR-205-3p	HITS-CLIP	21572407
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT515981	hsa-miR-8485	HITS-CLIP	21572407
MIRT515980	hsa-miR-603	HITS-CLIP	21572407
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT515978	hsa-miR-205-3p	HITS-CLIP	21572407
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT515981	hsa-miR-8485	HITS-CLIP	23313552
MIRT515980	hsa-miR-603	HITS-CLIP	23313552
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT515978	hsa-miR-205-3p	HITS-CLIP	23313552
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT610398	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT624694	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT624693	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT624691	hsa-miR-5193	HITS-CLIP	23824327
MIRT624692	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT624688	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT624694	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT624693	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT645483	hsa-miR-6871-5p	HITS-CLIP	23824327
MIRT624691	hsa-miR-5193	HITS-CLIP	23824327
MIRT624692	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT645482	hsa-miR-6878-5p	HITS-CLIP	23824327
MIRT645481	hsa-miR-6731-5p	HITS-CLIP	23824327
MIRT645479	hsa-miR-8085	HITS-CLIP	23824327
MIRT645480	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT645478	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT645477	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT624688	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT624694	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT624693	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT624691	hsa-miR-5193	HITS-CLIP	23824327
MIRT624692	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT624688	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT610398	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT624694	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT624693	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT624691	hsa-miR-5193	HITS-CLIP	23824327
MIRT624692	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT624690	hsa-miR-3926	HITS-CLIP	23824327
MIRT624689	hsa-miR-548s	HITS-CLIP	23824327
MIRT624688	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT624687	hsa-miR-16-2-3p	HITS-CLIP	23824327
MIRT624686	hsa-miR-195-3p	HITS-CLIP	23824327
MIRT054246	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT624685	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT610398	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT610398	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT550642	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT550640	hsa-miR-4307	PAR-CLIP	21572407
MIRT550641	hsa-miR-567	PAR-CLIP	21572407
MIRT550639	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT550637	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT550638	hsa-miR-8068	PAR-CLIP	21572407
MIRT550636	hsa-miR-3924	PAR-CLIP	21572407
MIRT550635	hsa-miR-675-3p	PAR-CLIP	21572407
MIRT550634	hsa-miR-297	PAR-CLIP	21572407
MIRT550633	hsa-miR-3149	PAR-CLIP	21572407
MIRT515981	hsa-miR-8485	PAR-CLIP	21572407
MIRT515980	hsa-miR-603	PAR-CLIP	21572407
MIRT515979	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT515978	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT515977	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT515982	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT515981	hsa-miR-8485	PAR-CLIP	21572407
MIRT515980	hsa-miR-603	PAR-CLIP	21572407
MIRT515979	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT515978	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT515977	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT515982	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT539176	hsa-miR-326	PAR-CLIP	22012620
MIRT539175	hsa-miR-330-5p	PAR-CLIP	22012620
MIRT539174	hsa-miR-4667-5p	PAR-CLIP	22012620
MIRT539173	hsa-miR-4700-5p	PAR-CLIP	22012620
MIRT539172	hsa-miR-8089	PAR-CLIP	22012620
MIRT539171	hsa-miR-637	PAR-CLIP	22012620
MIRT539170	hsa-miR-7155-5p	PAR-CLIP	22012620
MIRT539169	hsa-miR-6786-3p	PAR-CLIP	22012620
MIRT539167	hsa-miR-4696	PAR-CLIP	22012620
MIRT539168	hsa-miR-31-5p	PAR-CLIP	22012620
MIRT539166	hsa-miR-625-5p	PAR-CLIP	22012620
MIRT539165	hsa-miR-4723-5p	PAR-CLIP	22012620
MIRT539164	hsa-miR-5698	PAR-CLIP	22012620
MIRT539163	hsa-miR-6870-5p	PAR-CLIP	22012620
MIRT539162	hsa-miR-7111-5p	PAR-CLIP	22012620
MIRT539161	hsa-miR-4525	PAR-CLIP	22012620
MIRT539160	hsa-miR-5010-5p	PAR-CLIP	22012620
MIRT539159	hsa-miR-1275	PAR-CLIP	22012620
MIRT539158	hsa-miR-4665-5p	PAR-CLIP	22012620
MIRT539157	hsa-miR-381-3p	PAR-CLIP	22012620
MIRT515982	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT515981	hsa-miR-8485	PAR-CLIP	23446348
MIRT515980	hsa-miR-603	PAR-CLIP	23446348
MIRT515979	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT515978	hsa-miR-205-3p	PAR-CLIP	23446348
MIRT515977	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT481709	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT481708	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT481707	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT481706	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT481705	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT481704	hsa-miR-3612	PAR-CLIP	23592263
MIRT481703	hsa-miR-650	PAR-CLIP	23592263
MIRT481702	hsa-miR-4443	PAR-CLIP	23592263
MIRT481701	hsa-miR-4644	PAR-CLIP	23592263
MIRT481700	hsa-miR-548ac	PAR-CLIP	23592263
MIRT481699	hsa-miR-548bb-3p	PAR-CLIP	23592263
MIRT481698	hsa-miR-548d-3p	PAR-CLIP	23592263
MIRT481697	hsa-miR-548h-3p	PAR-CLIP	23592263
MIRT481696	hsa-miR-548z	PAR-CLIP	23592263
MIRT481695	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT481694	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT481693	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT481692	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT481690	hsa-miR-3148	PAR-CLIP	23592263
MIRT481691	hsa-miR-3153	PAR-CLIP	23592263
MIRT481689	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT481688	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT481687	hsa-miR-4271	PAR-CLIP	23592263
MIRT481686	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT481685	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT481684	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT481683	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT481682	hsa-miR-2110	PAR-CLIP	23592263
MIRT732952	hsa-miR-7-5p	Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	33118329
MIRT734660	hsa-miR-133a-5p	Luciferase reporter assay	31736422
MIRT734733	hsa-miR-1246	Luciferase reporter assayMicroarrayqRT-PCR	34226586
MIRT709810	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT709809	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT709808	hsa-miR-6818-5p	HITS-CLIP	19536157
MIRT709807	hsa-miR-147a	HITS-CLIP	19536157
MIRT709806	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT709805	hsa-miR-5010-3p	HITS-CLIP	19536157
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT515978	hsa-miR-205-3p	HITS-CLIP	21572407
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT515981	hsa-miR-8485	HITS-CLIP	21572407
MIRT515980	hsa-miR-603	HITS-CLIP	21572407
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT515978	hsa-miR-205-3p	HITS-CLIP	21572407
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT515981	hsa-miR-8485	HITS-CLIP	23313552
MIRT515980	hsa-miR-603	HITS-CLIP	23313552
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT515978	hsa-miR-205-3p	HITS-CLIP	23313552
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT610398	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT624694	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT624693	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT624691	hsa-miR-5193	HITS-CLIP	23824327
MIRT624692	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT624688	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT624694	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT624693	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT645483	hsa-miR-6871-5p	HITS-CLIP	23824327
MIRT624691	hsa-miR-5193	HITS-CLIP	23824327
MIRT624692	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT645482	hsa-miR-6878-5p	HITS-CLIP	23824327
MIRT645481	hsa-miR-6731-5p	HITS-CLIP	23824327
MIRT645479	hsa-miR-8085	HITS-CLIP	23824327
MIRT645480	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT645478	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT645477	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT624688	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT624694	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT624693	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT624691	hsa-miR-5193	HITS-CLIP	23824327
MIRT624692	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT624688	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT610398	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT624694	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT624693	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT624691	hsa-miR-5193	HITS-CLIP	23824327
MIRT624692	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT624690	hsa-miR-3926	HITS-CLIP	23824327
MIRT624689	hsa-miR-548s	HITS-CLIP	23824327
MIRT624688	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT624687	hsa-miR-16-2-3p	HITS-CLIP	23824327
MIRT624686	hsa-miR-195-3p	HITS-CLIP	23824327
MIRT054246	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT624685	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT610398	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT515981	hsa-miR-8485	HITS-CLIP	23824327
MIRT515980	hsa-miR-603	HITS-CLIP	23824327
MIRT515979	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT610400	hsa-miR-2115-3p	HITS-CLIP	23824327
MIRT610399	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT515977	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT610398	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT515982	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT550642	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT550640	hsa-miR-4307	PAR-CLIP	21572407
MIRT550641	hsa-miR-567	PAR-CLIP	21572407
MIRT550639	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT550637	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT550638	hsa-miR-8068	PAR-CLIP	21572407
MIRT550636	hsa-miR-3924	PAR-CLIP	21572407
MIRT550635	hsa-miR-675-3p	PAR-CLIP	21572407
MIRT550634	hsa-miR-297	PAR-CLIP	21572407
MIRT550633	hsa-miR-3149	PAR-CLIP	21572407
MIRT515981	hsa-miR-8485	PAR-CLIP	21572407
MIRT515980	hsa-miR-603	PAR-CLIP	21572407
MIRT515979	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT515978	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT515977	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT515982	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT515981	hsa-miR-8485	PAR-CLIP	21572407
MIRT515980	hsa-miR-603	PAR-CLIP	21572407
MIRT515979	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT515978	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT515977	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT515982	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT539176	hsa-miR-326	PAR-CLIP	22012620
MIRT539175	hsa-miR-330-5p	PAR-CLIP	22012620
MIRT539174	hsa-miR-4667-5p	PAR-CLIP	22012620
MIRT539173	hsa-miR-4700-5p	PAR-CLIP	22012620
MIRT539172	hsa-miR-8089	PAR-CLIP	22012620
MIRT539171	hsa-miR-637	PAR-CLIP	22012620
MIRT539170	hsa-miR-7155-5p	PAR-CLIP	22012620
MIRT539169	hsa-miR-6786-3p	PAR-CLIP	22012620
MIRT539167	hsa-miR-4696	PAR-CLIP	22012620
MIRT539168	hsa-miR-31-5p	PAR-CLIP	22012620
MIRT539166	hsa-miR-625-5p	PAR-CLIP	22012620
MIRT539165	hsa-miR-4723-5p	PAR-CLIP	22012620
MIRT539164	hsa-miR-5698	PAR-CLIP	22012620
MIRT539163	hsa-miR-6870-5p	PAR-CLIP	22012620
MIRT539162	hsa-miR-7111-5p	PAR-CLIP	22012620
MIRT539161	hsa-miR-4525	PAR-CLIP	22012620
MIRT539160	hsa-miR-5010-5p	PAR-CLIP	22012620
MIRT539159	hsa-miR-1275	PAR-CLIP	22012620
MIRT539158	hsa-miR-4665-5p	PAR-CLIP	22012620
MIRT539157	hsa-miR-381-3p	PAR-CLIP	22012620
MIRT515982	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT515981	hsa-miR-8485	PAR-CLIP	23446348
MIRT515980	hsa-miR-603	PAR-CLIP	23446348
MIRT515979	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT515978	hsa-miR-205-3p	PAR-CLIP	23446348
MIRT515977	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT481709	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT481708	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT481707	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT481706	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT481705	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT481704	hsa-miR-3612	PAR-CLIP	23592263
MIRT481703	hsa-miR-650	PAR-CLIP	23592263
MIRT481702	hsa-miR-4443	PAR-CLIP	23592263
MIRT481701	hsa-miR-4644	PAR-CLIP	23592263
MIRT481700	hsa-miR-548ac	PAR-CLIP	23592263
MIRT481699	hsa-miR-548bb-3p	PAR-CLIP	23592263
MIRT481698	hsa-miR-548d-3p	PAR-CLIP	23592263
MIRT481697	hsa-miR-548h-3p	PAR-CLIP	23592263
MIRT481696	hsa-miR-548z	PAR-CLIP	23592263
MIRT481695	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT481694	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT481693	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT481692	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT481690	hsa-miR-3148	PAR-CLIP	23592263
MIRT481691	hsa-miR-3153	PAR-CLIP	23592263
MIRT481689	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT481688	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT481687	hsa-miR-4271	PAR-CLIP	23592263
MIRT481686	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT481685	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT481684	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT481683	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT481682	hsa-miR-2110	PAR-CLIP	23592263
MIRT756456	hsa-miR-200c-3p	Western blottingqRT-PCR	36995683
MIRT791606	hsa-miR-130a	CLIP-seq
MIRT791607	hsa-miR-130b	CLIP-seq
MIRT791608	hsa-miR-301a	CLIP-seq
MIRT791609	hsa-miR-301b	CLIP-seq
MIRT791610	hsa-miR-3666	CLIP-seq
MIRT791611	hsa-miR-3678-3p	CLIP-seq
MIRT791612	hsa-miR-4295	CLIP-seq
MIRT791613	hsa-miR-454	CLIP-seq
MIRT791614	hsa-miR-4671-3p	CLIP-seq
MIRT1933525	hsa-miR-1185	CLIP-seq
MIRT1933526	hsa-miR-1321	CLIP-seq
MIRT1933527	hsa-miR-30a	CLIP-seq
MIRT1933528	hsa-miR-30b	CLIP-seq
MIRT1933529	hsa-miR-30c	CLIP-seq
MIRT1933530	hsa-miR-30d	CLIP-seq
MIRT1933531	hsa-miR-30e	CLIP-seq
MIRT1933532	hsa-miR-3117-5p	CLIP-seq
MIRT1933533	hsa-miR-3162-5p	CLIP-seq
MIRT1933534	hsa-miR-3185	CLIP-seq
MIRT1933535	hsa-miR-3605-5p	CLIP-seq
MIRT1933536	hsa-miR-3607-3p	CLIP-seq
MIRT1933537	hsa-miR-3679-5p	CLIP-seq
MIRT1933538	hsa-miR-4473	CLIP-seq
MIRT1933539	hsa-miR-4640-5p	CLIP-seq
MIRT1933540	hsa-miR-4718	CLIP-seq
MIRT1933541	hsa-miR-4726-5p	CLIP-seq
MIRT1933542	hsa-miR-4728-5p	CLIP-seq
MIRT1933543	hsa-miR-4739	CLIP-seq
MIRT1933544	hsa-miR-4756-5p	CLIP-seq
MIRT1933545	hsa-miR-4797-5p	CLIP-seq
MIRT1933546	hsa-miR-512-3p	CLIP-seq
MIRT1933547	hsa-miR-520f	CLIP-seq
MIRT1933525	hsa-miR-1185	CLIP-seq
MIRT2173605	hsa-miR-1206	CLIP-seq
MIRT2173606	hsa-miR-124	CLIP-seq
MIRT791606	hsa-miR-130a	CLIP-seq
MIRT791607	hsa-miR-130b	CLIP-seq
MIRT2173607	hsa-miR-2355-5p	CLIP-seq
MIRT2173608	hsa-miR-28-5p	CLIP-seq
MIRT2173609	hsa-miR-296-3p	CLIP-seq
MIRT2173610	hsa-miR-298	CLIP-seq
MIRT791608	hsa-miR-301a	CLIP-seq
MIRT791609	hsa-miR-301b	CLIP-seq
MIRT1933527	hsa-miR-30a	CLIP-seq
MIRT1933528	hsa-miR-30b	CLIP-seq
MIRT1933529	hsa-miR-30c	CLIP-seq
MIRT1933530	hsa-miR-30d	CLIP-seq
MIRT1933531	hsa-miR-30e	CLIP-seq
MIRT1933532	hsa-miR-3117-5p	CLIP-seq
MIRT2173611	hsa-miR-3125	CLIP-seq
MIRT2173612	hsa-miR-3139	CLIP-seq
MIRT2173613	hsa-miR-3158-5p	CLIP-seq
MIRT2173614	hsa-miR-3160-3p	CLIP-seq
MIRT2173615	hsa-miR-342-5p	CLIP-seq
MIRT1933535	hsa-miR-3605-5p	CLIP-seq
MIRT1933536	hsa-miR-3607-3p	CLIP-seq
MIRT2173616	hsa-miR-3617	CLIP-seq
MIRT791610	hsa-miR-3666	CLIP-seq
MIRT791611	hsa-miR-3678-3p	CLIP-seq
MIRT1933537	hsa-miR-3679-5p	CLIP-seq
MIRT2173617	hsa-miR-3916	CLIP-seq
MIRT2173618	hsa-miR-4253	CLIP-seq
MIRT791612	hsa-miR-4295	CLIP-seq
MIRT2173619	hsa-miR-433	CLIP-seq
MIRT2173620	hsa-miR-4418	CLIP-seq
MIRT1933538	hsa-miR-4473	CLIP-seq
MIRT2173621	hsa-miR-4487	CLIP-seq
MIRT2173622	hsa-miR-4494	CLIP-seq
MIRT2173623	hsa-miR-4514	CLIP-seq
MIRT791613	hsa-miR-454	CLIP-seq
MIRT1933539	hsa-miR-4640-5p	CLIP-seq
MIRT2173624	hsa-miR-4651	CLIP-seq
MIRT2173625	hsa-miR-4664-5p	CLIP-seq
MIRT791614	hsa-miR-4671-3p	CLIP-seq
MIRT2173626	hsa-miR-4692	CLIP-seq
MIRT1933540	hsa-miR-4718	CLIP-seq
MIRT1933541	hsa-miR-4726-5p	CLIP-seq
MIRT2173627	hsa-miR-4731-5p	CLIP-seq
MIRT2173628	hsa-miR-4766-5p	CLIP-seq
MIRT1933545	hsa-miR-4797-5p	CLIP-seq
MIRT2173629	hsa-miR-488	CLIP-seq
MIRT2173630	hsa-miR-499-3p	CLIP-seq
MIRT2173631	hsa-miR-499a-3p	CLIP-seq
MIRT2173632	hsa-miR-506	CLIP-seq
MIRT2173633	hsa-miR-509-3-5p	CLIP-seq
MIRT2173634	hsa-miR-509-5p	CLIP-seq
MIRT1933546	hsa-miR-512-3p	CLIP-seq
MIRT1933547	hsa-miR-520f	CLIP-seq
MIRT2173635	hsa-miR-556-5p	CLIP-seq
MIRT2173636	hsa-miR-558	CLIP-seq
MIRT2173637	hsa-miR-608	CLIP-seq
MIRT2173638	hsa-miR-641	CLIP-seq
MIRT2173639	hsa-miR-708	CLIP-seq
MIRT2173640	hsa-miR-877	CLIP-seq
MIRT1933532	hsa-miR-3117-5p	CLIP-seq
MIRT1933525	hsa-miR-1185	CLIP-seq
MIRT1933532	hsa-miR-3117-5p	CLIP-seq
MIRT2675208	hsa-miR-3591-3p	CLIP-seq
MIRT1933535	hsa-miR-3605-5p	CLIP-seq
MIRT1933537	hsa-miR-3679-5p	CLIP-seq
MIRT2675209	hsa-miR-3910	CLIP-seq
MIRT2675210	hsa-miR-4484	CLIP-seq
MIRT1933539	hsa-miR-4640-5p	CLIP-seq
MIRT1933541	hsa-miR-4726-5p	CLIP-seq
MIRT2675211	hsa-miR-548an	CLIP-seq

Show/Hide all (55)

Transcription factor	Regulation	Reference
CREB1	Unknown	15994978;21457548
CTNNB1	Unknown	16141201
E2F1	Activation	21099103
E2F1	Unknown	22508987
E2F4	Unknown	22508987
EGR1	Repression	15517885
ESR1	Activation	22391641
ETV1	Unknown	17505060
FOXH1	Repression	16120611
FOXM1	Activation	24583551
FOXO1	Repression	19074551
FOXO3	Activation	16061480
FOXO3	Unknown	17522055
FUS	Unknown	21909421
GATA2	Activation	24423874
HDAC1	Unknown	11971970
HEYL	Repression	21454491
HIF1A	Activation	17426252;21056661
JUN	Repression	20148354
JUN	Unknown	16732317
KDM4B	Activation	23435229
KHDRBS1	Unknown	18273831
LEF1	Unknown	19351848
MED1	Unknown	22102282
MEIS1	Unknown	25158280
NCOA2	Repression	17079484
NCOA4	Activation	16110473
NCOA4	Unknown	18156210
NCOR1	Activation	21720703
NCOR1	Unknown	16373395
NCOR2	Activation	21720703
NCOR2	Unknown	16373395
NFKB1	Repression	15517885
NFKB1	Unknown	16619263
NKX3-1	Repression	16697957
PA2G4	Unknown	20159994
PIAS2	Activation	11117529
POU2F1	Unknown	21387309
PURA	Repression	18413735;19790234
RELA	Repression	14715080;15517885
RELA	Unknown	16619263
REST	Unknown	24163104
RUNX2	Unknown	24648349
SOX9	Activation	17234760
SP1	Activation	15661808;18430409
SP1	Unknown	10773882
SREBF1	Unknown	20071336
STAT3	Unknown	23906537
TAF1	Activation	20181722
URI1	Repression	21730289
VHL	Activation	23961993
WHSC1	Unknown	19481544
WT1	Repression	11299720
YBX1	Unknown	21652770
ZEB1	Unknown	19921427;22391641

128

Show/Hide all (128)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12902338
GO:0000165	Process	MAPK cascade	IEA
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	17277772, 17505061
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18487222, 19886863
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	12799378
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16728402, 25802280
GO:0000979	Function	RNA polymerase II core promoter sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IPI	20181722
GO:0001223	Function	Transcription coactivator binding	IDA	10428808
GO:0001223	Function	Transcription coactivator binding	IPI	10428808
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16728402, 25802280
GO:0001701	Process	In utero embryonic development	IEA
GO:0003073	Process	Regulation of systemic arterial blood pressure	IEA
GO:0003382	Process	Epithelial cell morphogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	21730289
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11477070, 15572661
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	IDA	12799378, 16120611, 19244107
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	19244107
GO:0004879	Function	Nuclear receptor activity	IDA	17277772, 19886863, 20048160, 25091737
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IMP	19345326
GO:0004879	Function	Nuclear receptor activity	TAS	15572661
GO:0005102	Function	Signaling receptor binding	IPI	11875111
GO:0005496	Function	Steroid binding	IEA
GO:0005497	Function	Androgen binding	IDA	3353726, 12799378, 25091737
GO:0005515	Function	Protein binding	IPI	10075738, 10930412, 10987273, 11477070, 12864730, 14645241, 15563469, 15572661, 16027218, 16051670, 16120611, 16461912, 16494870, 16724108, 16951154, 17108144, 17170703, 17183365, 17202144, 17353003, 17426252, 17510388, 17909037, 18332867, 18451096, 18451177, 18487222, 18640093, 193
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15572661, 19244107, 19345326
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	15572661, 17510388, 19244107
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007165	Process	Signal transduction	TAS	10835690
GO:0007267	Process	Cell-cell signaling	TAS	10835690
GO:0007283	Process	Spermatogenesis	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0008013	Function	Beta-catenin binding	IDA	12799378
GO:0008013	Function	Beta-catenin binding	IPI	12799378
GO:0008013	Function	Beta-catenin binding	TAS	16344550
GO:0008270	Function	Zinc ion binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	17277772
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	14521927
GO:0008289	Function	Lipid binding	IEA
GO:0008584	Process	Male gonad development	IBA
GO:0008584	Process	Male gonad development	IEA
GO:0009566	Process	Fertilization	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	24681825
GO:0010628	Process	Positive regulation of gene expression	IMP	14521927
GO:0016607	Component	Nuclear speck	IDA	23566155
GO:0019102	Process	Male somatic sex determination	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	17277772, 17587566
GO:0030520	Process	Estrogen receptor signaling pathway	IDA	10428808
GO:0030520	Process	Estrogen receptor signaling pathway	IEA
GO:0030521	Process	Androgen receptor signaling pathway	IBA
GO:0030521	Process	Androgen receptor signaling pathway	IDA	19244107
GO:0030521	Process	Androgen receptor signaling pathway	IDA	10428808, 12799378, 16120611, 17277772, 19886863, 20048160, 20181722, 21310825
GO:0030521	Process	Androgen receptor signaling pathway	IEA
GO:0030521	Process	Androgen receptor signaling pathway	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IDA	17277772
GO:0032991	Component	Protein-containing complex	IDA	18468998
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IEA
GO:0033327	Process	Leydig cell differentiation	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0034056	Function	Estrogen response element binding	IBA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043568	Process	Positive regulation of insulin-like growth factor receptor signaling pathway	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IMP	14521927
GO:0045726	Process	Positive regulation of integrin biosynthetic process	IDA	21310825
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11477070
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12799378, 15572661, 16728402, 17277772, 17505061, 19244107, 20048160, 20181722
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19244107, 19345326
GO:0045945	Process	Positive regulation of transcription by RNA polymerase III	IDA	18487222
GO:0046872	Function	Metal ion binding	IEA
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0048608	Process	Reproductive structure development	IEA
GO:0048638	Process	Regulation of developmental growth	IEA
GO:0048645	Process	Animal organ formation	IEA
GO:0048808	Process	Male genitalia morphogenesis	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0051117	Function	ATPase binding	IDA	12058073
GO:0060090	Function	Molecular adaptor activity	IDA	11896058
GO:0060514	Process	Prostate induction	IEA
GO:0060571	Process	Morphogenesis of an epithelial fold	IEA
GO:0060599	Process	Lateral sprouting involved in mammary gland duct morphogenesis	IEA
GO:0060685	Process	Regulation of prostatic bud formation	IEA
GO:0060736	Process	Prostate gland growth	IEA
GO:0060740	Process	Prostate gland epithelium morphogenesis	IEA
GO:0060742	Process	Epithelial cell differentiation involved in prostate gland development	IEA
GO:0060748	Process	Tertiary branching involved in mammary gland duct morphogenesis	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0060769	Process	Positive regulation of epithelial cell proliferation involved in prostate gland development	IEA
GO:0061458	Process	Reproductive system development	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	12799378, 16120611
GO:0070974	Function	POU domain binding	IEA
GO:0071383	Process	Cellular response to steroid hormone stimulus	IMP	12902338
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	10428808
GO:0071394	Process	Cellular response to testosterone stimulus	IDA	10428808
GO:0071394	Process	Cellular response to testosterone stimulus	IEA
GO:0072520	Process	Seminiferous tubule development	IEA
GO:0140693	Function	Molecular condensate scaffold activity	IDA	33978290, 36229685
GO:0140694	Process	Membraneless organelle assembly	IDA	36229685
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	25802280
GO:1903076	Process	Regulation of protein localization to plasma membrane	IDA	21310825
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IDA	21310825

MIM	HGNC	e!Ensembl
313700	644	ENSG00000169083

P10275

Protein name

Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)

Protein function

Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues (PubMed:19022849). Transcription factor activity is modulated b

PDB

1E3G , 1GS4 , 1T5Z , 1T63 , 1T65 , 1XJ7 , 1XOW , 1XQ3 , 1Z95 , 2AM9 , 2AMA , 2AMB , 2AO6 , 2AX6 , 2AX7 , 2AX8 , 2AX9 , 2AXA , 2HVC , 2OZ7 , 2PIO , 2PIP , 2PIQ , 2PIR , 2PIT , 2PIU , 2PIV , 2PIW , 2PIX , 2PKL , 2PNU , 2Q7I , 2Q7J , 2Q7K , 2Q7L , 2YHD , 2YLO , 2YLP , 2YLQ , 2Z4J , 3B5R , 3B65 , 3B66 , 3B67 , 3B68 , 3BTR , 3L3X , 3L3Z , 3RLJ , 3RLL , 3V49

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02166	Androgen_recep	6 → 449	Androgen receptor	Family
PF00105	zf-C4	558 → 627	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	690 → 881	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 2]: Mainly expressed in heart and skeletal muscle. {ECO:0000269|PubMed:15634333}.; TISSUE SPECIFICITY: [Isoform 3]: Expressed in basal and stromal cells of the prostate (at protein level). {ECO:0000269|PubMed:19244107}.

Sequence

MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ
SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD
LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC
KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG
KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ
SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA
GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP
YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL
ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN
DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL
TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA
KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR
MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD
RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII
SVQVPKILSGKVKPIYFHTQ

Sequence length

920

Interactions

View interactions

	KEGG		Reactome
	Oocyte meiosis Pathways in cancer Chemical carcinogenesis - receptor activation Prostate cancer		HSP90 chaperone cycle for steroid hormone receptors (SHR) Nuclear Receptor transcription pathway SUMOylation of intracellular receptors Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 Ub-specific processing proteases RUNX2 regulates osteoblast differentiation

1634

Show/Hide Causal Diseases (24)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Absent axillary hair	Pathogenic	rs1555969528	RCV000626572
Absent pubic hair	Pathogenic	rs1555969528	RCV000626572
Androgen insensitivity, partial, with breast cancer	Pathogenic	rs137852576	RCV000010502
Androgen resistance syndrome	Likely pathogenic; Pathogenic	rs2147530857, rs367604031, rs2147436590, rs2076118553, rs2147525357, rs2147530924, rs1034866440, rs2147538369, rs2147540378, rs2147323184, rs2147436623, rs1929657778, rs2147540656, rs2147530668, rs2147530793 View all (186 more)	RCV001375948 RCV001391229 RCV001385554 RCV001380446 RCV001391228 RCV001533213 RCV001787231 RCV001568309 RCV001568310 RCV001787234 RCV001726694 RCV001787235 RCV001787236 RCV001808075 RCV002542705 RCV002275264 RCV005225521 RCV001848590 RCV001848601 RCV002035910 RCV001867583 RCV001964227 RCV001923647 RCV001927307 RCV001991264 RCV001946527 RCV001960660 RCV001960720 RCV001946629 RCV001963282 RCV001920317 RCV002021449 RCV002331856 RCV002251259 RCV002272646 RCV002272808 RCV002273090 RCV002283648 RCV002284026 RCV002289067 RCV002302851 RCV002310618 RCV002466924 RCV002471897 RCV002472280 RCV003064728 RCV003064729 RCV003041450 RCV003041451 RCV003050617 RCV002625804 RCV002815395 RCV002797041 RCV002802182 RCV002835205 RCV002851524 RCV002970595 RCV002985696 RCV003033737 RCV003000181 RCV003130941 RCV000010478 RCV000010479 RCV000010480 RCV000698414 RCV000010482 RCV000010485 RCV000640478 RCV000010488 RCV000010489 RCV000010490 RCV000010493 RCV000806067 RCV000532628 RCV000010499 RCV000582333 RCV000010529 RCV000010506 RCV000010511 RCV000010512 RCV000010513 RCV000010516 RCV005222678 RCV000010522 RCV000010524 RCV000010526 RCV000010527 RCV000010528 RCV000010530 RCV000010532 RCV000010533 RCV000010534 RCV000640477 RCV000258807 RCV001787093 RCV000583276 RCV000532795 RCV000584628 RCV000582566 RCV001859531 RCV003229546 RCV005216043 RCV003320007 RCV003883995 RCV003778233 RCV003459914 RCV003459915 RCV003459916 RCV003494493 RCV003783769 RCV003783770 RCV003783771 RCV003783773 RCV003783775 RCV003783776 RCV003782752 RCV003783034 RCV003779439 RCV003807925 RCV003807953 RCV003804236 RCV003802931 RCV003802670 RCV003802052 RCV003802424 RCV003815673 RCV003801744 RCV003815492 RCV003802553 RCV003985963 RCV003985976 RCV003986003 RCV003986047 RCV004595378 RCV000415036 RCV003766746 RCV000499725 RCV000501357 RCV000583701 RCV000529989 RCV000546202 RCV000554118 RCV001384434 RCV000557358 RCV000554482 RCV001377727 RCV000535980 RCV000534959 RCV000528841 RCV000546100 RCV001381488 RCV000547141 RCV000542858 RCV000543473 RCV001376911 RCV000583962 RCV000581586 RCV000582975 RCV000584652 RCV000583130 RCV000584351 RCV000582429 RCV000582115 RCV000583799 RCV000581269 RCV000582497 RCV000583716 RCV000581364 RCV000582655 RCV000583865 RCV000581949 RCV000584020 RCV000584561 RCV000583403 RCV000583496 RCV000582850 RCV000583629 RCV000584242 RCV000581866 RCV000640476 RCV000640475 RCV000660882 RCV000701672 RCV000702048 RCV000704129 RCV000705046 RCV000697147 RCV000700147 RCV000796993 RCV000798376 RCV000800702 RCV000815852 RCV000806051 RCV000815871 RCV000814876 RCV000804161 RCV000810850 RCV000991197 RCV001049499 RCV001056832 RCV001070365 RCV001169865 RCV001218858 RCV001219621 RCV001223380 RCV001206102 RCV001212478 RCV001208881 RCV001262662 RCV001268946 RCV004691403 RCV001270904
Aplasia of the uterus	Pathogenic	rs1555969528	RCV000626572
AR-related disorder	Pathogenic; Likely pathogenic	rs137852564, rs2519608153, rs2147322941, rs2147537756, rs2519845669, rs2519612537, rs1925886715	RCV003421916 RCV003402554 RCV003427941 RCV003404520 RCV003983406 RCV003943869 RCV003396726
Differences in sex development	Pathogenic; Likely pathogenic	rs9332969, rs137852577, rs9332971, rs1555995851, rs1057523747, rs143040492	RCV005865175 RCV005865176 RCV005865286 RCV005865355 RCV005865356 RCV005865357
Disorder of sexual differentiation	Pathogenic	rs137852569	RCV005241234
Female external genitalia in individual with 46,XY karyotype	Pathogenic	rs1555969528	RCV000626572
Hypospadias 1, X-linked	Pathogenic; Likely pathogenic	rs137852564, rs137852574, rs141425171, rs143040492	RCV000763628 RCV000010498 RCV005051283 RCV003222053
Kennedy disease	Likely pathogenic; Pathogenic	rs2147530857, rs367604031, rs2147436590, rs2076118553, rs2147530924, rs2147530668, rs2147537840, rs2147535891, rs2147525149, rs766161615, rs2147313671, rs1929683441, rs2147535489, rs2076119092, rs2147497993 View all (111 more)	RCV001865883 RCV001390825 RCV001385554 RCV001380446 RCV003771874 RCV002542705 RCV005225521 RCV005225526 RCV002035910 RCV001867583 RCV001964227 RCV001923647 RCV001927307 RCV001991264 RCV001946527 RCV001960660 RCV001960720 RCV001946629 RCV001963282 RCV001920317 RCV002021449 RCV003775494 RCV003064728 RCV003064729 RCV003041450 RCV003041451 RCV003050617 RCV002625804 RCV002815395 RCV002797041 RCV002802182 RCV002835205 RCV002851524 RCV002970595 RCV002985696 RCV003033737 RCV003000181 RCV001056795 RCV000763628 RCV000698414 RCV000640478 RCV000010492 RCV001384255 RCV000806067 RCV000532628 RCV000814875 RCV000640474 RCV005222678 RCV001059742 RCV005222679 RCV001851781 RCV000640477 RCV005222863 RCV000532795 RCV003765576 RCV000696602 RCV001859531 RCV005216043 RCV003778233 RCV003783769 RCV003783770 RCV003783771 RCV003783773 RCV003783775 RCV003783776 RCV003782752 RCV003783034 RCV003779439 RCV003807925 RCV003807953 RCV003804236 RCV003802931 RCV003802670 RCV003802052 RCV003802424 RCV003815673 RCV003801744 RCV003815492 RCV003802553 RCV003766746 RCV005222977 RCV000529989 RCV000791383 RCV000554118 RCV001384434 RCV000557358 RCV000554482 RCV001377727 RCV000535980 RCV000534959 RCV000528841 RCV000546100 RCV001381488 RCV000547141 RCV000542858 RCV001387509 RCV001376911 RCV005223013 RCV001853948 RCV001860107 RCV005223014 RCV000687621 RCV000640476 RCV000640475 RCV003767919 RCV000701672 RCV000702048 RCV000704129 RCV000705046 RCV000697147 RCV000700147 RCV000796993 RCV000798376 RCV000800702 RCV000815852 RCV000806051 RCV000815871 RCV000814876 RCV000804161 RCV000810850 RCV001049499 RCV001056832 RCV001070365 RCV001218858 RCV001219621 RCV001223380 RCV001206102 RCV001212478 RCV001208881 RCV001380447
Male infertility	Pathogenic; Likely pathogenic	rs2147537806, rs9332971, rs141425171, rs1218564193, rs2147524850, rs764684648	RCV003984022 RCV003982834 RCV003984357 RCV003983766 RCV003983767 RCV003983768
Male infertility with azoospermia or oligozoospermia due to single gene mutation	Likely pathogenic	rs2147321167	RCV003991619
Neoplasm	Pathogenic	rs137852578, rs137852581, rs886041132	RCV004668712 RCV006273049 RCV006273693
Non-obstructive azoospermia	Pathogenic	rs2147537806	RCV001648509
Nonpapillary renal cell carcinoma	Likely pathogenic	rs2147525149, rs1555995848	RCV005925595 RCV005901277
Ovarian cancer	Likely pathogenic	rs879021764, rs1441671810, rs555361360, rs758962274, rs2147321608	RCV003154751 RCV003154769 RCV003154770 RCV003154783 RCV003154803
Partial androgen insensitivity syndrome	Likely pathogenic; Pathogenic	rs2147524833, rs137852564, rs137852567, rs137852569, rs137852573, rs9332971, rs9332969, rs137852577, rs104894742, rs2147497386, rs137852590, rs137852592, rs1602278831, rs137852600, rs137852601 View all (7 more)	RCV002273049 RCV000763628 RCV000010484 RCV000010487 RCV000010494 RCV000010496 RCV000010497 RCV000010503 RCV000010504 RCV000010515 RCV000010518 RCV000010519 RCV000010521 RCV000010525 RCV000010531 RCV000010535 RCV001175283 RCV004720249 RCV003238162 RCV005051283 RCV000517655 RCV006252380 RCV004789218
Prostate cancer	Pathogenic; Likely pathogenic	rs1281274698, rs774645775, rs772490323, rs768869912, rs864622007, rs137852564	RCV002249258 RCV002249262 RCV002249264 RCV002249267 RCV000204071 RCV000763628
Prostate cancer, hereditary, X-linked 3	Likely pathogenic; Pathogenic	rs141425171	RCV005051283
Prostate cancer, somatic	Pathogenic	rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	RCV000010483 RCV000010505 RCV000010507 RCV000010508 RCV000010509
Pure gonadal dysgenesis 46,XY	Pathogenic	rs1929774367	RCV003492240
See cases	Pathogenic	rs2147538127, rs2519840760	RCV003128526 RCV003128527
Thyroid cancer, nonmedullary, 1	Likely pathogenic	rs2147524993	RCV005930332

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Castleman-Kojima disease	Conflicting classifications of pathogenicity	rs1800053	RCV000824699
Cervical cancer	Likely benign	rs113613897	RCV005917623
Cholangiocarcinoma	Benign	rs2361635	RCV005924719
Familial cancer of breast	Benign	rs2361635	RCV005924717
Familial prostate cancer	Conflicting classifications of pathogenicity	rs200185441	RCV004796181
Lung cancer	Benign	rs2361635	RCV005924720
Ovarian serous cystadenocarcinoma	Likely benign	rs113613897	RCV005917624
Posterior hypospadias	Conflicting classifications of pathogenicity	rs200185441	RCV005355784
Prostate cancer susceptibility	Conflicting classifications of pathogenicity	rs137852593	RCV000010523
Thymoma	Likely benign	rs113613897	RCV005917625
Uterine carcinosarcoma	Benign	rs2361635	RCV005924718
Uterine corpus endometrial carcinoma	Likely benign	rs113613897	RCV005917626

Show/Hide Text Mining Associations (370)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
46 XY female	Associate	21311178, 32216057
Abortion Spontaneous	Associate	28707146
Achalasia Addisonianism Alacrimia syndrome	Associate	19921427, 31413553
Acne Vulgaris	Associate	19172534, 31249215, 34998793, 36585988
Adenocarcinoma	Associate	12445232, 18007998, 20126616, 24618694, 25274033, 26671992, 27072221, 29052817, 29605661, 32091413, 32512818, 33664492, 33817721, 34133324, 35219875, 35963852, 36149194, 37240308 View all (3 more)
Adenocarcinoma Mucinous	Associate	18508419
Adenocarcinoma Mucinous	Inhibit	19887463
Adenoma	Associate	31522216
Adenoma Pleomorphic	Associate	19061288, 20027446, 20711118, 30484070
Adenomatous Polyposis Coli	Associate	7521342
Adrenal Hyperplasia Congenital	Associate	24884994
Adrenal hyperplasia congenital type 5	Associate	26845730
Adrenocortical Carcinoma	Associate	31759122
Agnosia	Associate	21325075
Alopecia	Associate	11231320, 15902657, 16382684, 18304493, 18385763, 18849991, 19373488, 24244503, 24742982, 24855036, 34998793, 35545365, 36446804
Alopecia	Stimulate	19141591, 35102171
Alzheimer Disease	Associate	23545426
Amenorrhea	Associate	17852420, 20672904, 37346838
Androgen Insensitivity Syndrome	Associate	10404311, 10428170, 10458483, 10617653, 10840043, 11144509, 12682377, 12801411, 1426313, 1430233, 15724799, 15812177, 1609793, 16365032, 16400085 View all (113 more)
Angiomyolipoma	Associate	18374399
Anorchia	Associate	22909003
Antley Bixler Syndrome Phenotype	Associate	20410220
Anxiety Disorders	Associate	28158988
Aortic Aneurysm Abdominal	Associate	31413553
Aromatase deficiency	Associate	17852420
Arrest of spermatogenesis	Associate	11172827, 11330644, 11545293, 12877254, 19937586, 36945970
Arthritis Rheumatoid	Associate	10419869, 22040886, 27355582
Aspartylglucosaminuria	Associate	19373488
Asthma	Stimulate	31299143
Asthma	Associate	33779531
Ataxia	Associate	24913494
Atherosclerosis	Associate	37505165
Atrophy	Associate	24789081, 31604846, 34784541
Autism Spectrum Disorder	Associate	19167832, 26910733
Autistic Disorder	Associate	19167832, 23801657
Autonomic Nervous System Diseases	Associate	25047668
Azoospermia	Associate	11172827, 12399527, 12634316, 17919607, 19168451, 23884765, 24919724, 28659371, 40215689, 7926115
Azoospermia Nonobstructive	Associate	27089915
Biliary Tract Neoplasms	Associate	20200439
Blood Platelet Disorders	Associate	32692888
Bohring syndrome	Associate	35432193
Bone Diseases	Associate	19257827
Brain Diseases	Associate	28467804, 35231560
Brain Neoplasms	Associate	28467804, 32366278
Breast Diseases	Associate	37549632
Breast Neoplasms	Associate	10205268, 11005214, 11437399, 11862478, 14973115, 15625768, 15743497, 15772083, 16457685, 16567872, 16791593, 16977795, 16987421, 17465263, 18275596 View all (151 more)
Breast Neoplasms	Inhibit	24552459, 33660830
Breast Neoplasms Male	Associate	10070897, 10617653, 14680496, 21505847, 22142662, 23272232, 27003765, 29092024, 29396493, 30577860, 36494460, 500829
Bulbo Spinal Atrophy X Linked	Associate	10400640, 10486315, 11330644, 11335100, 12824190, 12968071, 15830083, 19497852, 19846582, 21247881, 22829593, 23364790, 23744686, 24041967, 24814851 View all (23 more)
Calcinosis	Associate	31005169
Calcinosis Cutis	Associate	17299418, 20173765, 20338164, 22722839, 24379448, 24948877, 30033370, 30591548, 31515456, 31604846, 32094488, 35183184, 36453547, 36766786, 37563129
Cap Myopathy	Associate	14691288, 17935158, 18708348, 18762779, 20634343, 23576568, 23922223, 24634161, 24694733, 25409505, 26876983, 27587619, 27606620, 28826481, 32879302, 35456428 View all (1 more)
Carcinogenesis	Associate	11278645, 19840198, 20098441, 22922989, 23041672, 23272232, 24207095, 25315188, 25781993, 25943311, 30367117, 30509050, 30577860, 31772120, 31978895 View all (4 more)
Carcinogenesis	Stimulate	37806457
Carcinoma Acinar Cell	Associate	21336263, 30912411
Carcinoma Adenoid Cystic	Associate	20027446, 30382367
Carcinoma Adenosquamous	Associate	10622536
Carcinoma Basal Cell	Stimulate	33797847
Carcinoma Basal Cell	Associate	35552660
Carcinoma Ductal	Associate	18508419, 21109569, 23605249, 30570854, 39666421
Carcinoma Ductal	Inhibit	25588857
Carcinoma Ductal Breast	Associate	11825917, 17465263, 30284987
Carcinoma Endometrioid	Associate	29210800
Carcinoma Endometrioid	Stimulate	32583986, 40186889
Carcinoma Giant Cell	Associate	20976389
Carcinoma Hepatocellular	Associate	17191310, 18768969, 20049203, 22819717, 23620780, 24586606, 25217983, 29144509, 31685543, 31759122, 32548867, 32579541, 33118329, 33328560, 34664394, 38182647 View all (1 more)
Carcinoma in Situ	Associate	21642359, 25048477, 40010639, 9288632
Carcinoma Intraductal Noninfiltrating	Associate	11825917, 18043578, 21109569, 29193395, 32928183, 35933669
Carcinoma Intraductal Noninfiltrating	Stimulate	31989433
Carcinoma Lobular	Associate	25837163
Carcinoma Mucoepidermoid	Stimulate	20027446
Carcinoma Mucoepidermoid	Associate	29385707
Carcinoma Neuroendocrine	Inhibit	27034170, 32649013
Carcinoma Non Small Cell Lung	Associate	21713768, 37564195
Carcinoma Ovarian Epithelial	Associate	11572759, 26556855, 28467804, 32366278, 32718331, 34321053
Carcinoma Ovarian Epithelial	Stimulate	21614520
Carcinoma Renal Cell	Associate	26814892, 31427547, 31759122, 33797847, 35452181, 39336758
Carcinoma Renal Cell	Stimulate	33817721
Carcinoma Small Cell	Associate	21336263
Carcinoma Small Cell	Inhibit	32649013
Carcinoma Squamous Cell	Associate	10622536, 32991423
Carcinoma Transitional Cell	Associate	34784541
Cataract congenital dominant non nuclear	Associate	26667715
Cell Transformation Neoplastic	Associate	21652578
Central Serous Chorioretinopathy	Associate	38263930
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	22986532, 33563753
Cerebral Small Vessel Diseases	Associate	35231560
Chemical and Drug Induced Liver Injury	Associate	35713052
Cholangiocarcinoma	Associate	31978895
Chromosome Xp11.3 Deletion Syndrome	Associate	35452181
Churg Strauss Syndrome	Associate	10029594
Cirrhosis Familial	Associate	12427778
Clear cell metastatic renal cell carcinoma	Associate	37725629
Cleft Palate	Associate	26845730, 34646402
Coffin Lowry Syndrome	Associate	19302446
Colonic Neoplasms	Associate	25301365
Colorectal Neoplasms	Associate	30804124, 31522216
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Associate	26848581
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	27110943
Congenital thrombotic disease due to Protein C deficiency	Associate	24469092
Coronary Artery Disease	Associate	25716092, 30193537
Coronary Disease	Inhibit	26097556
COVID 19	Associate	33305659, 33522308, 33529978, 33647767, 34225789, 36375449
Cryptorchidism	Associate	16813680, 16957138, 22906643, 37377277
Cystic Disease Of Lung	Associate	25070172
Cysts	Associate	23573315, 32863342
Death	Associate	18349820, 18562628, 22080055, 26541420, 32053149
Death Sudden	Associate	26097556
Depressive Disorder	Associate	28447621
Desmoid disease hereditary	Associate	10732754, 17077595, 23035734
dhat syndrome	Associate	36142533
Diabetes Mellitus	Associate	29249638
Diabetes Mellitus Type 1	Associate	30113450
Diabetes Mellitus Type 2	Stimulate	29249638
Disease	Associate	19877028, 23364790
Disease Resistance	Associate	21563193, 22128178, 33500577
Disorder of Sex Development 46 XY	Associate	18342859, 20056211, 20150575, 20198568, 20410220, 22909003, 24186597, 26778393, 32985417
Disorders of Sex Development	Associate	20150575, 22909003, 24186597, 25047668, 27583472, 29022558, 31429517, 33182400, 33750429, 34233262, 34833359, 35135181
DNA Virus Infections	Associate	31310591, 35317841
Drug Hypersensitivity	Associate	10029594
Drug Related Side Effects and Adverse Reactions	Associate	12824190, 21448923, 35867854, 36585400, 36982155
Dupuytren Contracture	Associate	11853085
Dyskeratosis Congenita	Associate	9310472
Edema	Associate	37346838
Endocrine System Diseases	Associate	18978937, 21949845, 25296973, 26918604, 29773186, 33822745
Endometrial Hyperplasia	Associate	17465263, 30745857, 9916939
Endometrial Neoplasms	Associate	18334972, 19190146, 19775474, 20053928, 23962788, 27384477, 28782227, 29747687, 31256208, 32583986, 37725629, 39205690, 40186889, 7856759
Endometrial Neoplasms	Inhibit	26930451
Endometriosis	Associate	20063560, 26134036, 29664547, 36860677
Endometriosis	Stimulate	21614520
Enhanced S Cone Syndrome	Associate	35452181
Erectile Dysfunction	Associate	26216079, 30333254, 37551851
Esophageal Neoplasms	Associate	25724186
Esophageal Squamous Cell Carcinoma	Stimulate	25724186
Fatigue	Associate	27052658
Fever	Stimulate	22890844
Fibrocystic Breast Disease	Associate	10690175, 20846920
Fibrosis	Associate	34999838
Gallbladder Neoplasms	Associate	24009453
GATA2 Deficiency	Associate	15466379, 23958352
Genetic Diseases Inborn	Associate	32694570
Genital Diseases Male	Associate	25180665
Gingival Overgrowth	Associate	24206119
Glioblastoma	Associate	25315188, 34681618, 35633167, 35661403, 36361793, 38233838
Glioblastoma	Stimulate	31759122, 36235203
Glioma	Associate	28423563, 31759122, 39333688
Gliosis	Associate	31779094
Gonadal Disorders	Associate	10428170
Granulosa Cell Tumor	Associate	25297715
Growth Disorders	Associate	18273818
Gynecomastia	Associate	20305676, 26845730, 27087292, 37058074
Heart Block	Associate	22665440
Heart Failure Systolic	Associate	30193537
Hemophilia A	Associate	19302446, 37145012
Hemophilia B	Associate	9233568
Hepatitis B	Associate	21552212
Hepatitis B Chronic	Associate	24391916
Hereditary Breast and Ovarian Cancer Syndrome	Associate	22471922, 22825604, 23929266, 24850180, 35134468
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	24570075
Hereditary leiomyomatosis and renal cell cancer	Associate	15316901
Hernia Inguinal	Associate	20888558, 37346838
Herpes Labialis	Associate	20305676
Hip Injuries	Associate	37148822
Hirsutism	Associate	10770223, 19172534, 29584789, 32863342, 34998793
Huntington Disease	Associate	21247881, 36585400
Hyperandrogenism	Associate	19172534, 20865044, 23599814, 25552498, 25825716, 26848581, 31256208, 36799021
Hypereosinophilic Syndrome	Associate	10029594
Hyperglycemia	Associate	21597087
Hyperkinesis	Associate	26910733
Hyperlipidemia Familial Combined	Associate	23877856
Hyperostosis corticalis deformans juvenilis	Associate	15920545, 29082243
Hyperplasia	Associate	27072221, 36149194
Hypertension	Associate	30085300
Hypertrophy	Associate	23744686
Hypogonadism	Associate	26209787, 35233984
Hypospadias	Associate	16957138, 17343741, 20305676, 21937623, 22391641, 22909003, 23167717, 8097257
Hypospadias	Inhibit	32515122
Hypoxia	Associate	19151763, 36720985
Hypoxia	Stimulate	26264969, 26888452, 35302608, 35536859, 36230969
Hypoxia Brain	Associate	33182844
Immune System Diseases	Stimulate	22157983
Immunologic Deficiency Syndromes	Associate	33011098
Inclusion body myopathy autosomal recessive	Associate	20497190
Infections	Associate	28957431
Infertility	Associate	12801573, 16400085, 20150575, 20198568, 20305676, 24186597, 24691874, 25925349
Infertility Male	Associate	11172827, 11591412, 16400085, 19168451, 19937586, 20198568, 28659371, 36142533, 36945970, 39596257
Inflammation	Stimulate	22157983
Inflammation	Associate	27226548, 27672034, 28611094, 32846021, 35713052
Inflammation	Inhibit	31730277
Inflammatory Breast Neoplasms	Associate	24634055
Insulin Resistance	Associate	18535544
Intellectual Disability	Associate	9039995
Keratosis Seborrheic	Associate	11286615
Klinefelter Syndrome	Associate	28611373, 32216057
Laron Syndrome	Associate	32948192
Lateral meningocele syndrome	Associate	15316901
Leiomyoma	Associate	15704521, 20063560, 9176406
Leiomyosarcoma	Associate	29533018
Leprosy Borderline	Associate	34999838
Leukemia	Associate	12135669
Leukemia Myeloid Acute	Associate	12135669, 31759122
Liver Diseases	Associate	37038004
Liver Failure Acute	Associate	24391916
Long QT Syndrome	Inhibit	21505847
Lung Neoplasms	Associate	30008631, 37716981
Lung Neoplasms	Inhibit	37564195
Lupus Erythematosus Systemic	Associate	21445561, 34797837
Lymphatic Metastasis	Associate	11005214, 25588857, 29059676, 37634315
Lymphatic Metastasis	Stimulate	24925052
Lymphoma Mantle Cell	Associate	28115200
Lymphoma T Cell	Associate	23958352
MASS syndrome	Associate	26667715
Mastocytosis	Associate	9378823
Melanoma	Associate	27210747, 31116991, 31940495, 37838724
Melanoma Cutaneous Malignant	Associate	31759122
Mental Retardation X Linked 45	Associate	18273818
Mesenteric Cyst	Associate	34999838
Mesothelioma Malignant	Associate	25471750
Metabolic Diseases	Associate	30113450
Metabolic Syndrome	Associate	18645714
Metaphyseal chondrodysplasia with cone shaped epiphyses normal hair and normal hands	Associate	27725361
Metaplasia	Associate	10690175
Mitochondrial Diseases	Associate	35867854
Mohr Tranebjaerg syndrome	Stimulate	37564195
Mood Disorders	Associate	28447621
Mouth Diseases	Associate	12620481
Mouth Neoplasms	Associate	21781458
Mucopolysaccharidosis II	Associate	21829674
Mullerian aplasia	Associate	10428170
Multiple Endocrine Neoplasia Type 1	Associate	10551325
Multiple Sclerosis	Associate	31779094
Muscular Atrophy	Associate	20610535, 31319382, 34986150
Muscular Diseases	Associate	20610535
Muscular Disorders Atrophic	Associate	24789081
Myelodysplastic Syndromes	Associate	17607372
Myelolipoma	Associate	24884994
Myeloproliferative Disorders	Associate	9929111
Myositis	Associate	12707036
Necrosis	Stimulate	19898421
Necrosis	Associate	21448923
Neoplasm Invasiveness	Stimulate	24634055
Neoplasm Invasiveness	Inhibit	25588857
Neoplasm Invasiveness	Associate	31427547
Neoplasm Metastasis	Associate	14691288, 19366804, 21552559, 22531786, 24244276, 24403250, 24925052, 25588857, 25830880, 26071481, 26250344, 26552477, 27003765, 27497761, 28555048 View all (25 more)
Neoplasm Metastasis	Stimulate	28400549, 31054895, 34193246
Neoplasm Metastasis	Inhibit	33118329
Neoplasm Residual	Associate	33755225
Neoplasms	Associate	10428170, 10428464, 10823139, 11144509, 11259089, 11438457, 11742035, 11815965, 11862478, 12139238, 12429819, 12445232, 12888829, 14609956, 14691288 View all (263 more)
Neoplasms	Inhibit	19668381, 19887463, 22039516, 22403609, 23354516, 24581183, 24687926, 29808619, 32413024, 32649013, 33615860, 35121110, 35617398, 37142586, 37352376, 38310103 View all (1 more)
Neoplasms	Stimulate	25378314, 26487496, 27300431, 31253132, 34999838, 37009898, 37060201, 40616536
Neoplasms Cystic Mucinous and Serous	Associate	11572759
Neoplasms Cystic Mucinous and Serous	Stimulate	32583986
Neoplasms Germ Cell and Embryonal	Associate	10428170, 21642359, 24186138, 27873769
Neoplasms Nerve Tissue	Associate	10601839
Neoplasms Neuroepithelial	Associate	25534237
Nerve Degeneration	Associate	19497852
Neural Tube Defects	Associate	15994236
Neuroblastoma	Associate	12968071
Neurodegenerative Diseases	Associate	19497852, 36585400
Neuroendocrine Tumors	Associate	26671992, 34999838, 35617398, 37289025, 38238517
Neuroma Acoustic	Associate	23354516
Non Muscle Invasive Bladder Neoplasms	Associate	29862474, 30961575
Obesity	Associate	25925349
Oculocerebrorenal Syndrome	Associate	39286977
Oligospermia	Associate	11330644, 19168451, 20198568, 22829593, 37936145, 7926115
Oncogene Addiction	Associate	38182647
Optic atrophy X linked	Associate	8170488
Osteoporosis	Associate	36815982
Osteosarcoma	Associate	26249023, 28262798
Ovarian Diseases	Associate	10823139, 28472976, 31759122
Ovarian Dysgenesis 2	Associate	20672904
Ovarian Neoplasms	Inhibit	10318951
Ovarian Neoplasms	Associate	11437399, 15545219, 15994977, 19623182, 22022581, 25608477, 26556855, 28467804, 32366278, 33891016, 34763937, 35134468, 35639349
Paget Disease Extramammary	Associate	11005214, 15920545, 29082243, 31899853, 37634315
Paget's Disease Mammary	Associate	15920545, 31899853, 35364707
Pallidopyramidal syndrome	Associate	23364790
Pancreatic Neoplasms	Associate	29115476
Pdgfrb Associated Chronic Eosinophilic Leukemia	Associate	10029594, 17607372
Pelvic Organ Prolapse	Associate	37430099
Penis agenesis	Associate	20305676
Peritoneal Diseases	Associate	14607565
Peritonitis	Associate	30804124, 9176406
Persistent Infection	Associate	23877856
Personality Disorders	Associate	12230620, 28981526
Phyllodes Tumor of the Prostate	Associate	17192792
Polycystic Ovary Syndrome	Associate	18191848, 18303071, 18555222, 19172534, 20865044, 22724574, 23599814, 25237893, 25552498, 25825716, 27725361, 31256208, 32283997, 32412125, 32488141 View all (5 more)
Porokeratosis punctata palmaris et plantaris	Associate	39978376
Poroma	Associate	18516291, 20208479, 21045236, 21310761, 23663520, 30899086, 39978376
Post Infectious Disorders	Associate	24855036
Prader Willi Syndrome	Associate	25925349
Premature Birth	Associate	23227263
Premature Ejaculation	Associate	30019487
Primary hyperoxaluria type 2	Associate	35135181
Primary Ovarian Insufficiency	Associate	18281036, 20672904
Prostate cancer familial	Associate	10574254, 20173765, 28257035
Prostate Cancer Hereditary 7	Associate	30237440, 33619025
Prostatic Diseases	Associate	18217192, 18560202, 18627423, 19645433, 25409505
Prostatic Hyperplasia	Associate	10343609, 15310009, 18217192, 22157983, 23792768, 26709083, 27226548, 30028845, 32412125, 35821619
Prostatic Intraepithelial Neoplasia	Associate	20601956, 27072221
Prostatic Intraepithelial Neoplasia	Stimulate	31054895
Prostatic Neoplasms	Associate	10075669, 10318905, 10428808, 10500149, 10569618, 10574254, 10638964, 10670524, 10779504, 10884916, 11005214, 11016951, 11140692, 11248024, 11278645 View all (1029 more)
Prostatic Neoplasms	Inhibit	22014572, 32512818, 33463130
Prostatic Neoplasms	Stimulate	25512540, 30958616, 31054895, 31756402, 32343676, 32560654
Prostatic Neoplasms Castration Resistant	Associate	12429819, 12888829, 14660748, 15897571, 17696745, 18349820, 18819102, 19117982, 19339269, 19351840, 19366804, 19477425, 19632176, 19664042, 19706771 View all (246 more)
Prostatic Neoplasms Castration Resistant	Inhibit	20404538, 32690869, 35550030, 35849143, 39300962
Prostatic Neoplasms Castration Resistant	Stimulate	21365123, 32343676
Prostatitis	Associate	10638964, 10884916, 11248024, 11278645, 11438457, 11857595, 12368219, 12429819, 12445232, 12799378, 12890669, 14609956, 14691288, 15029260, 15630701 View all (77 more)
Prostatitis	Inhibit	25977336
Prostatitis	Stimulate	39294048
Pulmonary Sclerosing Hemangioma	Associate	17873892
Pyruvate Carboxylase Deficiency Disease	Associate	22558290, 33755225, 34129855, 34592899, 35905714, 36114082, 36824501
Recombinant chromosome 8 syndrome	Associate	28851861, 37438515
Reproductive Tract Infections	Associate	22829593, 26209787
Retinal Dysplasia	Associate	11438457
Salivary Duct Calculi	Stimulate	19886710
Salivary Duct Calculi	Associate	27103403, 28681314, 29492965, 30267779, 30390196, 30484070, 31430492, 31609094, 31745978, 31772120, 32103349, 32350809, 32457410, 33039794, 39304797
Salivary Gland Adenoma Pleomorphic	Associate	20711118, 37247295
Salivary Gland Neoplasms	Associate	24618694, 28681314, 29211833, 29385707, 32310325, 34232601
Sarcoma Kaposi	Associate	26076995, 34543357, 39349354, 9301550, 9653174
Sarcopenia	Associate	20610535
Schizophrenia	Associate	28359301
Sebaceous Gland Neoplasms	Associate	24930483, 34043754
Seizures	Associate	31414730
Seminoma	Associate	21642359
Sertoli Cell Only Syndrome	Associate	19361789, 40215689
Sertoli Leydig Cell Tumor	Associate	17852420
Skin Diseases	Associate	29972220
Sleep Apnea Syndromes	Associate	26888452
Sleep Disorders Circadian Rhythm	Associate	29211833
Spondylodysplasia And Premature Pubarche	Associate	27725361
Squamous Cell Carcinoma of Head and Neck	Associate	21781458
Status Asthmaticus	Associate	31299143
Stomach Neoplasms	Associate	23199240, 26206497, 27893427, 28388558, 31759122, 37431884, 37806457
Syndrome	Associate	15833816
Tarlov Cysts	Stimulate	24768607
Tarlov Cysts	Associate	30912411
Telomeric 22q13 Monosomy Syndrome	Associate	23363843, 26336104
Teratozoospermia	Associate	19937586, 20198568
Tertiary Lymphoid Structures	Associate	17146782
Tertiary Lymphoid Structures	Stimulate	29386247
Testicular Diseases	Associate	16950754, 33741265, 37058074
Testicular Germ Cell Tumor	Associate	21642359
Testicular Neoplasms	Associate	11144509, 25180665, 27873769, 33741265
Thrombocytosis	Associate	11166459
Thymus Neoplasms	Associate	21437890
Thyroid Hormone Resistance Syndrome	Associate	12888829, 1430233, 29118296
Tn Syndrome	Associate	34217971
Tremor	Associate	34922802
Triple Negative Breast Neoplasms	Associate	19531543, 19887463, 19921427, 22638807, 23373898, 23549873, 23582599, 23929266, 24505496, 24779793, 25208879, 25588857, 25743329, 26039245, 26051240 View all (54 more)
Triple Negative Breast Neoplasms	Inhibit	20507730
Trophoblastic Tumor Placental Site	Associate	10879746
Turcot syndrome	Inhibit	29210800
Turner Syndrome	Associate	10680293, 18273818
Urethral Neoplasms	Associate	18845648, 30509050, 37762034, 38423597
Urinary Bladder Diseases	Associate	25178641
Urinary Bladder Neoplasms	Associate	14736285, 18845648, 21400613, 22922989, 25048477, 26517808, 26885620, 27322140, 28869948, 29659560, 30961575, 31119584, 33549708, 33797847, 34576193 View all (5 more)
Urinary Incontinence	Associate	31319382
Urogenital Abnormalities	Associate	38197270, 8097257, 8099270
Urologic Neoplasms	Associate	27635763, 38423597
Uterine Cervical Dysplasia	Associate	36951594
Uterine Cervical Neoplasms	Associate	26210472
Uterine Diseases	Associate	9094973
Uterine Neoplasms	Inhibit	16357844
Venous Thrombosis	Associate	30577860
Virilism	Associate	18479901, 20126616, 20305676, 35135181
Virilism	Stimulate	22540830
Virilism	Inhibit	27185910
X Inactivation Familial Skewed 1	Associate	33021557
X Linked Combined Immunodeficiency Diseases	Associate	7883965
Xeroderma Pigmentosum	Associate	21157430

AR (androgen receptor)