Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3655
Gene name Gene Name - the full gene name approved by the HGNC.	Integrin subunit alpha 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ITGA6
Synonyms (NCBI Gene) Gene synonyms aliases	CD49f, ITGA6A, ITGA6B, JEB6, VLA-6
Disease Acronyms (UniProt) Disease acronyms from UniProt database	JEB6
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs863223349	AGA>-	Likely-pathogenic	Coding sequence variant, 3 prime UTR variant, inframe deletion
rs1559159868	A>-	Pathogenic	Coding sequence variant, frameshift variant, intron variant

Show/Hide all(167)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023546	hsa-miR-1-3p	Proteomics	18668040
MIRT023546	hsa-miR-1-3p	Microarray	18668037
MIRT025291	hsa-miR-34a-5p	Proteomics	21566225
MIRT028271	hsa-miR-32-5p	Sequencing	20371350
MIRT028474	hsa-miR-30a-5p	Proteomics	18668040
MIRT046458	hsa-miR-15b-5p	CLASH	23622248
MIRT437371	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437371	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437371	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437371	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437372	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437372	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437372	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437372	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437373	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437373	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437373	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437373	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24091622
MIRT437372	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT437372	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT086118	hsa-miR-92b-3p	Luciferase reporter assay, Western blot	28036265
MIRT086118	hsa-miR-92b-3p	Luciferase reporter assay, Western blot	28036265
MIRT735096	hsa-miR-302b-3p	Western blotting, qRT-PCR	32806777
MIRT739675	hsa-miR-181a	CLIP-seq
MIRT739672	hsa-miR-181b	CLIP-seq
MIRT739671	hsa-miR-181c	CLIP-seq
MIRT739674	hsa-miR-181d	CLIP-seq
MIRT739673	hsa-miR-4262	CLIP-seq
MIRT739676	hsa-miR-4436a	CLIP-seq
MIRT1073653	hsa-miR-103a	CLIP-seq
MIRT1073654	hsa-miR-107	CLIP-seq
MIRT1073655	hsa-miR-1224-5p	CLIP-seq
MIRT1073656	hsa-miR-1252	CLIP-seq
MIRT1073657	hsa-miR-1265	CLIP-seq
MIRT1073658	hsa-miR-1267	CLIP-seq
MIRT1073659	hsa-miR-129-5p	CLIP-seq
MIRT1073660	hsa-miR-1301	CLIP-seq
MIRT1073661	hsa-miR-1468	CLIP-seq
MIRT1073662	hsa-miR-1537	CLIP-seq
MIRT1073663	hsa-miR-208a	CLIP-seq
MIRT1073664	hsa-miR-208b	CLIP-seq
MIRT1073665	hsa-miR-224	CLIP-seq
MIRT1073666	hsa-miR-2392	CLIP-seq
MIRT1073667	hsa-miR-25	CLIP-seq
MIRT1073668	hsa-miR-300	CLIP-seq
MIRT1073669	hsa-miR-3157-5p	CLIP-seq
MIRT1073670	hsa-miR-3171	CLIP-seq
MIRT1073671	hsa-miR-3174	CLIP-seq
MIRT1073672	hsa-miR-32	CLIP-seq
MIRT1073673	hsa-miR-3617	CLIP-seq
MIRT1073674	hsa-miR-363	CLIP-seq
MIRT1073675	hsa-miR-3646	CLIP-seq
MIRT1073676	hsa-miR-3658	CLIP-seq
MIRT1073677	hsa-miR-3662	CLIP-seq
MIRT1073678	hsa-miR-367	CLIP-seq
MIRT1073679	hsa-miR-377	CLIP-seq
MIRT1073680	hsa-miR-381	CLIP-seq
MIRT1073681	hsa-miR-3915	CLIP-seq
MIRT1073682	hsa-miR-3976	CLIP-seq
MIRT1073683	hsa-miR-4261	CLIP-seq
MIRT1073684	hsa-miR-4282	CLIP-seq
MIRT1073685	hsa-miR-4468	CLIP-seq
MIRT1073686	hsa-miR-4496	CLIP-seq
MIRT1073687	hsa-miR-450b-5p	CLIP-seq
MIRT1073688	hsa-miR-4519	CLIP-seq
MIRT1073689	hsa-miR-4640-3p	CLIP-seq
MIRT1073690	hsa-miR-4666-3p	CLIP-seq
MIRT1073691	hsa-miR-4678	CLIP-seq
MIRT1073692	hsa-miR-4689	CLIP-seq
MIRT1073693	hsa-miR-4691-3p	CLIP-seq
MIRT1073694	hsa-miR-4722-3p	CLIP-seq
MIRT1073695	hsa-miR-4769-3p	CLIP-seq
MIRT1073696	hsa-miR-4789-5p	CLIP-seq
MIRT1073697	hsa-miR-494	CLIP-seq
MIRT1073698	hsa-miR-499-3p	CLIP-seq
MIRT1073699	hsa-miR-499-5p	CLIP-seq
MIRT1073700	hsa-miR-499a-3p	CLIP-seq
MIRT1073701	hsa-miR-5047	CLIP-seq
MIRT1073702	hsa-miR-507	CLIP-seq
MIRT1073703	hsa-miR-548u	CLIP-seq
MIRT1073704	hsa-miR-557	CLIP-seq
MIRT1073705	hsa-miR-641	CLIP-seq
MIRT1073706	hsa-miR-653	CLIP-seq
MIRT1073707	hsa-miR-92a	CLIP-seq
MIRT1073708	hsa-miR-92b	CLIP-seq
MIRT2018199	hsa-miR-1283	CLIP-seq
MIRT2018200	hsa-miR-142-5p	CLIP-seq
MIRT2018201	hsa-miR-3140-5p	CLIP-seq
MIRT2018202	hsa-miR-340	CLIP-seq
MIRT1073685	hsa-miR-4468	CLIP-seq
MIRT2018203	hsa-miR-4729	CLIP-seq
MIRT2018204	hsa-miR-548g	CLIP-seq
MIRT2018205	hsa-miR-892a	CLIP-seq
MIRT1073657	hsa-miR-1265	CLIP-seq
MIRT2250078	hsa-miR-186	CLIP-seq
MIRT1073663	hsa-miR-208a	CLIP-seq
MIRT1073664	hsa-miR-208b	CLIP-seq
MIRT1073666	hsa-miR-2392	CLIP-seq
MIRT1073667	hsa-miR-25	CLIP-seq
MIRT2250079	hsa-miR-3133	CLIP-seq
MIRT1073672	hsa-miR-32	CLIP-seq
MIRT1073673	hsa-miR-3617	CLIP-seq
MIRT1073674	hsa-miR-363	CLIP-seq
MIRT1073676	hsa-miR-3658	CLIP-seq
MIRT1073678	hsa-miR-367	CLIP-seq
MIRT1073691	hsa-miR-4678	CLIP-seq
MIRT1073698	hsa-miR-499-3p	CLIP-seq
MIRT1073699	hsa-miR-499-5p	CLIP-seq
MIRT1073700	hsa-miR-499a-3p	CLIP-seq
MIRT2250080	hsa-miR-548al	CLIP-seq
MIRT2250081	hsa-miR-548c-3p	CLIP-seq
MIRT1073705	hsa-miR-641	CLIP-seq
MIRT1073707	hsa-miR-92a	CLIP-seq
MIRT1073708	hsa-miR-92b	CLIP-seq
MIRT2389488	hsa-miR-101	CLIP-seq
MIRT2389489	hsa-miR-1243	CLIP-seq
MIRT2389490	hsa-miR-125a-3p	CLIP-seq
MIRT1073657	hsa-miR-1265	CLIP-seq
MIRT2389491	hsa-miR-1285	CLIP-seq
MIRT2389492	hsa-miR-130a	CLIP-seq
MIRT2389493	hsa-miR-130b	CLIP-seq
MIRT2389494	hsa-miR-144	CLIP-seq
MIRT1073663	hsa-miR-208a	CLIP-seq
MIRT1073664	hsa-miR-208b	CLIP-seq
MIRT2389495	hsa-miR-2355-5p	CLIP-seq
MIRT1073667	hsa-miR-25	CLIP-seq
MIRT2389496	hsa-miR-301a	CLIP-seq
MIRT2389497	hsa-miR-301b	CLIP-seq
MIRT2389498	hsa-miR-3126-3p	CLIP-seq
MIRT2018201	hsa-miR-3140-5p	CLIP-seq
MIRT2389499	hsa-miR-3187-5p	CLIP-seq
MIRT1073672	hsa-miR-32	CLIP-seq
MIRT1073673	hsa-miR-3617	CLIP-seq
MIRT2389500	hsa-miR-3622a-3p	CLIP-seq
MIRT2389501	hsa-miR-3622b-3p	CLIP-seq
MIRT1073674	hsa-miR-363	CLIP-seq
MIRT2389502	hsa-miR-3654	CLIP-seq
MIRT1073676	hsa-miR-3658	CLIP-seq
MIRT2389503	hsa-miR-3659	CLIP-seq
MIRT2389504	hsa-miR-3665	CLIP-seq
MIRT2389505	hsa-miR-3666	CLIP-seq
MIRT1073678	hsa-miR-367	CLIP-seq
MIRT2389506	hsa-miR-4280	CLIP-seq
MIRT2389507	hsa-miR-4295	CLIP-seq
MIRT2389508	hsa-miR-4328	CLIP-seq
MIRT1073688	hsa-miR-4519	CLIP-seq
MIRT2389509	hsa-miR-454	CLIP-seq
MIRT2389510	hsa-miR-4658	CLIP-seq
MIRT2389511	hsa-miR-4704-5p	CLIP-seq
MIRT2389512	hsa-miR-4738-3p	CLIP-seq
MIRT1073698	hsa-miR-499-3p	CLIP-seq
MIRT1073699	hsa-miR-499-5p	CLIP-seq
MIRT1073700	hsa-miR-499a-3p	CLIP-seq
MIRT2389513	hsa-miR-574-5p	CLIP-seq
MIRT2389514	hsa-miR-612	CLIP-seq
MIRT1073705	hsa-miR-641	CLIP-seq
MIRT2389515	hsa-miR-657	CLIP-seq
MIRT2389516	hsa-miR-891b	CLIP-seq
MIRT1073707	hsa-miR-92a	CLIP-seq
MIRT1073708	hsa-miR-92b	CLIP-seq
MIRT2553614	hsa-miR-297	CLIP-seq
MIRT2553615	hsa-miR-3149	CLIP-seq
MIRT1073685	hsa-miR-4468	CLIP-seq
MIRT1073691	hsa-miR-4678	CLIP-seq
MIRT2389512	hsa-miR-4738-3p	CLIP-seq
MIRT2553616	hsa-miR-586	CLIP-seq
MIRT2553617	hsa-miR-643	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
POU5F1	Activation	22311737
SOX2	Activation	22311737

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	2649503, 9360996, 15466886, 21880726
GO:0005886	Component	Plasma membrane	IDA	21310825
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007044	Process	Cell-substrate junction assembly	TAS	9185503
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0009986	Component	Cell surface	HDA	23658023
GO:0009986	Component	Cell surface	IDA	19933311, 20563599, 23154389
GO:0010668	Process	Ectodermal cell differentiation	IEP	23154389
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0030175	Component	Filopodium	IEA
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030335	Process	Positive regulation of cell migration	IMP	24091622
GO:0031581	Process	Hemidesmosome assembly	TAS
GO:0031589	Process	Cell-substrate adhesion	IMP	19933311
GO:0031994	Function	Insulin-like growth factor I binding	IDA	22351760
GO:0034676	Component	Integrin alpha6-beta4 complex	IEA
GO:0035878	Process	Nail development	IMP	23496044
GO:0038132	Function	Neuregulin binding	IDA	20682778
GO:0042327	Process	Positive regulation of phosphorylation	IMP	21310825
GO:0043065	Process	Positive regulation of apoptotic process	IGI	19364818
GO:0043236	Function	Laminin binding	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IMP	25911094
GO:0043589	Process	Skin morphogenesis	IMP	23496044
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	21310825
GO:0046872	Function	Metal ion binding	IEA
GO:0050900	Process	Leukocyte migration	TAS
GO:0071407	Process	Cellular response to organic cyclic compound	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IMP	21310825

MIM	HGNC	e!Ensembl
147556	6142	ENSG00000091409

Protein

UniProt ID

P23229

Protein name

Integrin alpha-6 (CD49 antigen-like family member F) (VLA-6) (CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain; Integrin alpha-6 light chain; Processed integrin alpha-6 (Alpha6p)]

Protein function

Integrin alpha-6/beta-1 (ITGA6:ITGB1) is a receptor for laminin on platelets (By similarity). Integrin alpha-6/beta-1 (ITGA6:ITGB1) is present in oocytes and is involved in sperm-egg fusion (By similarity). Integrin alpha-6/beta-4 (ITGA6:ITGB4)

PDB

7CEB , 7CEC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01839	FG-GAP	355 → 393	FG-GAP repeat	Repeat
PF08441	Integrin_alpha2	503 → 978	Integrin alpha	Family

Tissue specificity

TISSUE SPECIFICITY: Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoforms containing segment X1 are ubiquitously expressed. Isoforms containing segment X1X2 are expressed in heart, kidney, placenta, colon, duodenum, myoblasts and myotu

Sequence

MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETEHDESLVPVPANSYLGLLFLTSVSYTDPDQFVYKTRPPREQPDTFPDVMMNSYLGFS
LDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGYDVA
VVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGRWNNVKPIRLNGTKDSMFGIAV
KNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMD
LDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKS
CFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKV
CMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHF
LKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNS
PSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQNGSQADCELGN
PFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSG
VAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLTNLGTATLNIQWPKEISN
GKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAER
KYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEEYSKLNYLDILMRAFIDV
TAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILVAILAGILMLALLVFILWKCGF
FKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQWITKWNENESYS

Sequence length

1130

Interactions

View interactions

	KEGG		Reactome
	PI3K-Akt signaling pathway Focal adhesion ECM-receptor interaction Cell adhesion molecules Hematopoietic cell lineage Regulation of actin cytoskeleton Cytoskeleton in muscle cells Toxoplasmosis Human papillomavirus infection Pathways in cancer Small cell lung cancer Hypertrophic cardiomyopathy Arrhythmogenic right ventricular cardiomyopathy Dilated cardiomyopathy		Assembly of collagen fibrils and other multimeric structures Basigin interactions Integrin cell surface interactions Laminin interactions Syndecan interactions Type I hemidesmosome assembly

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Anonychia	ANONYCHIA	rs74315420, rs74315421, rs74315422, rs74315423, rs387907026, rs387907027, rs387907028, rs780261665, rs775644973, rs370554150
Aplasia cutis congenita	Aplasia Cutis Congenita	rs587777706
Arthrogryposis multiplex congenita	Arthrogryposis	rs1586285494, rs80358233, rs137853305, rs1559154278, rs398124167, rs398124172, rs587780399, rs786204576, rs786204430, rs769345284, rs749355583, rs793888524, rs793888525, rs878854368, rs555445835 View all (138 more)
Epidermolysis bullosa	Epidermolysis bullosa with pyloric atresia	rs137852757, rs80356682, rs80356680, rs786205094, rs121912482, rs786205095, rs587776813, rs121912487, rs587776814, rs1558092501, rs80356683, rs118203899, rs118203900, rs1558095794, rs118203901 View all (97 more)	9185503, 26817667
Junctional epidermolysis bullosa with pyloric atresia	Junctional epidermolysis bullosa with pyloric atresia	rs794726676, rs121912461, rs121912462, rs80338755, rs121912463, rs147222357, rs121912464, rs121912465, rs1434530468, rs121912467, rs121912468, rs758551913, rs879255260, rs886041205, rs752657203, rs772142634, rs551348450, rs545619665 View all (3 more)
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	17379860

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	Source
Unknown
Renal dysplasia	Renal Cell Dysplasia, Renal dysplasia		ClinVar
Epidermolysis Bullosa	epidermolysis bullosa, junctional 6, with pyloric atresia		GenCC
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.	GWAS, CBGDA
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA

Show/Hide Text Mining Associations (87)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	34818353
Adenocarcinoma of Lung	Associate	35029906
Aicardi Syndrome	Associate	37040084
Anemia Sickle Cell	Associate	32987729
Arthritis Rheumatoid	Associate	9849316
Arthropathy progressive pseudorheumatoid of childhood	Associate	8751975
Asthma	Associate	29769273, 32494122
Barrett Esophagus	Associate	34818353
Blister	Associate	1694890
Breast Neoplasms	Associate	22791584, 25269750, 25445919, 25450398, 26695635, 27001172, 27624978, 28084338, 29909039, 30850363, 32494122, 33500458, 34626053, 38250718
Cap Myopathy	Associate	21820706
Carcinoma	Associate	22331423
Carcinoma Hepatocellular	Associate	24304619, 29425759
Carcinoma Hepatocellular	Stimulate	35657344
Carcinoma Non Small Cell Lung	Associate	35007184, 35447118
Carcinoma Squamous Cell	Associate	26499463
Carotid Artery Diseases	Associate	36959587
Classical Lissencephalies and Subcortical Band Heterotopias	Associate	34347028
Colorectal Neoplasms	Associate	26674523, 26895101, 30536996, 34257702
COVID 19	Associate	33413422
Dermatitis Atopic	Associate	37540585
Developmental Disabilities	Associate	34347028
Diabetes Mellitus Type 2	Associate	35898457
Ectodermal Dysplasia	Associate	9185503
Epidermolysis Bullosa	Associate	1694890, 9546354
Epidermolysis Bullosa Junctional	Associate	8751975, 9158140
Epidermolysis bullosa with pyloric atresia	Associate	15654962, 39322060, 9185503
Esophageal Squamous Cell Carcinoma	Associate	31345182, 35835740, 36290884
Familial duodenal atresia	Associate	9158140
Glioblastoma	Associate	26992919, 30467961, 37821547
Glioma	Associate	35044082
Hemangiosarcoma	Associate	7682756
Hirschsprung Disease	Associate	34471485
Hodgkin Disease	Associate	21820706
Inflammation	Associate	23570247
Inflammatory Bowel Disease 25 Autosomal Recessive	Associate	34525210
Leiomyosarcoma	Inhibit	7682756
Leukemia	Associate	18831072, 23233446, 31894899
Leukemia B Cell	Associate	18831072
Leukemia Myeloid Acute	Associate	23233446, 26439029
Leukemia Myeloid Acute	Stimulate	35289472
Leukemia Plasma Cell	Inhibit	33785876
Leukoplakia Hairy	Associate	10918561
Lung Neoplasms	Associate	8080732
Lymphatic Metastasis	Associate	25472585
Lymphedema	Associate	33785876
Lymphoma Follicular	Associate	20220060
Melanoma	Associate	1991990
Mental Disorders	Associate	26508570
Multiple Myeloma	Associate	21820706, 33785876
Multiple Sclerosis	Inhibit	9708801
Muscular Dystrophy Duchenne	Associate	20382434, 32157826
Mycosis Fungoides	Associate	1384339
Myelodysplastic Syndromes	Stimulate	35289472
Nasopharyngeal Carcinoma	Associate	12746479, 16306614, 30772768
Neoplasm Metastasis	Associate	16306614, 22813880, 24304619, 30536996, 30772768, 30894280, 35168644, 40083708, 9846970
Neoplasm Metastasis	Inhibit	33785876
Neoplasms	Associate	20220060, 20353996, 22112299, 23450810, 23570247, 23593654, 24008095, 24091622, 25450398, 25472585, 26239765, 26311223, 26499463, 27001172, 28249895 View all (12 more)
Neoplasms	Stimulate	27624978
Neoplasms	Inhibit	30772768
Neurilemmoma	Associate	7682756
Neuroblastoma	Associate	31406249
Neurofibrosarcoma	Inhibit	7682756
Neuroma Acoustic	Associate	33176868
Osteoporotic Fractures	Stimulate	32602654
Osteosarcoma	Associate	40083708
Ovarian Neoplasms	Associate	20628624, 28328815, 35168644
Pancreatic Neoplasms	Associate	19825166, 29764514, 30894280
Paraproteinemias	Associate	33785876
Paroxysmal ventricular fibrillation	Stimulate	32602654
Pemphigoid Bullous	Associate	1694890
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Stimulate	18831072
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	18831072, 31894899
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	20220060
Prostatic Neoplasms	Associate	17303120, 20651075, 23071686, 23106339, 23450810, 24497940, 25371445, 27509031, 28494073, 36095024
Prostatitis	Associate	19938015, 23071686
Pyloric Atresia	Associate	9546354
Radiation Injuries	Associate	27624978
Schizophrenia Childhood	Associate	26508570
Squamous Cell Carcinoma of Head and Neck	Associate	28415821, 30431092, 34326893, 35820930, 39376501
Squamous Cell Carcinoma of Head and Neck	Stimulate	33099569
Squamous Intraepithelial Lesions	Associate	37410084
Stomach Neoplasms	Associate	25472585
Thymoma	Associate	8456937
Triple Negative Breast Neoplasms	Associate	24008095, 24982892, 28084338, 37836626
Uterine Cervical Neoplasms	Associate	27132080, 30908730, 37410084
Uterine Cervical Neoplasms	Stimulate	30791957

ITGA6 (integrin subunit alpha 6)