Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3646
Gene name Gene Name - the full gene name approved by the HGNC.	Eukaryotic translation initiation factor 3 subunit E
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EIF3E
Synonyms (NCBI Gene) Gene synonyms aliases	EIF3-P48, EIF3S6, INT6, eIF3-p46
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q23.1

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020499	hsa-miR-155-5p	Proteomics	18668040
MIRT031475	hsa-miR-16-5p	Proteomics	18668040
MIRT049969	hsa-miR-29a-3p	CLASH	23622248
MIRT639798	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT639797	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT440738	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440738	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT639798	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT639797	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT957563	hsa-miR-224	CLIP-seq
MIRT957564	hsa-miR-3620	CLIP-seq
MIRT957565	hsa-miR-369-3p	CLIP-seq
MIRT957566	hsa-miR-374a	CLIP-seq
MIRT957567	hsa-miR-374b	CLIP-seq
MIRT957568	hsa-miR-410	CLIP-seq
MIRT957569	hsa-miR-4282	CLIP-seq
MIRT957570	hsa-miR-4517	CLIP-seq
MIRT957571	hsa-miR-4698	CLIP-seq
MIRT957572	hsa-miR-4781-3p	CLIP-seq
MIRT957573	hsa-miR-4795-3p	CLIP-seq
MIRT957574	hsa-miR-584	CLIP-seq
MIRT957575	hsa-miR-590-3p	CLIP-seq
MIRT957576	hsa-miR-633	CLIP-seq
MIRT957563	hsa-miR-224	CLIP-seq
MIRT957564	hsa-miR-3620	CLIP-seq
MIRT957568	hsa-miR-410	CLIP-seq
MIRT957569	hsa-miR-4282	CLIP-seq
MIRT957570	hsa-miR-4517	CLIP-seq
MIRT957571	hsa-miR-4698	CLIP-seq
MIRT957572	hsa-miR-4781-3p	CLIP-seq
MIRT957570	hsa-miR-4517	CLIP-seq
MIRT957571	hsa-miR-4698	CLIP-seq
MIRT957572	hsa-miR-4781-3p	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000184	Process	Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IMP	17468741
GO:0000785	Component	Chromatin	NAS	17468741
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003743	Function	Translation initiation factor activity	IC	9295280
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	17581632, 25849773
GO:0005515	Function	Protein binding	IPI	10504338, 16189514, 17324924, 17468741, 18599441, 18628297, 19748344, 20890303, 22190034, 23623729, 24092755, 24705354, 25416956, 28514442, 30833792, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	10504338
GO:0005654	Component	Nucleoplasm	NAS	17468741
GO:0005737	Component	Cytoplasm	IDA	10504338
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA	21873635
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	9295280, 17322308, 17581632, 18599441, 25849773
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	NAS	10504338
GO:0006413	Process	Translational initiation	IBA	21873635
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IDA	17581632
GO:0006413	Process	Translational initiation	TAS
GO:0006446	Process	Regulation of translational initiation	NAS	9295280, 17468741
GO:0016020	Component	Membrane	HDA	19946888
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0016605	Component	PML body	IDA	10504338
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045727	Process	Positive regulation of translation	IPI	24092755
GO:0045947	Process	Negative regulation of translational initiation	NAS	10504338
GO:0047485	Function	Protein N-terminus binding	IPI	10504338
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071540	Component	Eukaryotic translation initiation factor 3 complex, eIF3e	IEA
GO:1902416	Process	Positive regulation of mRNA binding	IPI	24092755

MIM	HGNC	e!Ensembl
602210	3277	ENSG00000104408

Protein

UniProt ID

P60228

Protein name

Eukaryotic translation initiation factor 3 subunit E (eIF3e) (Eukaryotic translation initiation factor 3 subunit 6) (Viral integration site protein INT-6 homolog) (eIF-3 p48)

Protein function

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40

PDB

3J8B , 3J8C , 6FEC , 6YBD , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8RG0 , 8XXN , 9BLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09440	eIF3_N	5 → 138	eIF3 subunit 6 N terminal domain	Domain
PF01399	PCI	290 → 395	PCI domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at highest levels in appendix, lymph, pancreas, skeletal muscle, spleen and thymus. {ECO:0000269|PubMed:8688078, ECO:0000269|PubMed:9295280}.

Sequence

MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKN
LYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK
HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ
NWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQP
QYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY
VNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKL
NMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM
NIEKKLNQNSRSEAPNWATQDSGFY

Sequence length

445

Interactions

View interactions

	KEGG		Reactome
	Hepatitis C		L13a-mediated translational silencing of Ceruloplasmin expression Translation initiation complex formation Formation of a pool of free 40S subunits Formation of the ternary complex, and subsequently, the 43S complex Ribosomal scanning and start codon recognition GTP hydrolysis and joining of the 60S ribosomal subunit

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	21379329
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	27602772

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Oligodendroglioma	Oligodendroglioma		GWAS
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.	GWAS, CBGDA

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	11121040, 22508697, 26056130
Breast Neoplasms	Inhibit	27550454
Carcinogenesis	Associate	11071922, 11121040, 22508697, 25123227
Colonic Neoplasms	Associate	25400724
Colorectal Neoplasms	Associate	15750208
Colorectal Neoplasms	Stimulate	25400724
Dupuytren Contracture	Associate	21732829, 34573275
Glioblastoma	Associate	24481065
Lung Neoplasms	Associate	36116043
Lymphatic Metastasis	Stimulate	25400724
Neoplasm Metastasis	Stimulate	25400724
Neoplasm Metastasis	Associate	26056130
Neoplasms	Associate	11121040, 15030549, 25400724, 36116043, 38266053
Tertiary Lymphoid Structures	Stimulate	25400724
Urinary Bladder Neoplasms	Associate	21672358

EIF3E (eukaryotic translation initiation factor 3 subunit E)