Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3635
Gene name Gene Name - the full gene name approved by the HGNC.	Inositol polyphosphate-5-phosphatase D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	INPP5D
Synonyms (NCBI Gene) Gene synonyms aliases	SHIP, SHIP-1, SHIP1, SIP-145, hp51CN, p150Ship
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	Luciferase reporter assay, Western blot	20041145
MIRT000631	hsa-miR-155-5p	Luciferase reporter assay	19359473
MIRT000631	hsa-miR-155-5p	Review	20144731
MIRT000631	hsa-miR-155-5p	Review	20029422
MIRT000631	hsa-miR-155-5p	GFP reporter assay, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	19641183
MIRT000631	hsa-miR-155-5p	Reporter assay	20041145
MIRT000631	hsa-miR-155-5p	Reporter assay;Western blot;qRT-PCR;Other	19359473
MIRT030268	hsa-miR-26b-5p	Microarray	19088304
MIRT038735	hsa-miR-93-3p	CLASH	23622248
MIRT000631	hsa-miR-155-5p	qRT-PCR, Western blot	22982040
MIRT000631	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	24522920
MIRT000631	hsa-miR-155-5p	EMSA, Flow, Luciferase reporter assay, qRT-PCR, Western blot	25971362
MIRT000631	hsa-miR-155-5p	qRT-PCR	36071352
MIRT1067364	hsa-miR-1271	CLIP-seq
MIRT1067365	hsa-miR-3614-5p	CLIP-seq
MIRT1067366	hsa-miR-3659	CLIP-seq
MIRT1067367	hsa-miR-4255	CLIP-seq
MIRT1067368	hsa-miR-4658	CLIP-seq
MIRT1067369	hsa-miR-574-5p	CLIP-seq
MIRT1067370	hsa-miR-96	CLIP-seq
MIRT1067371	hsa-miR-214	CLIP-seq
MIRT1067372	hsa-miR-3619-5p	CLIP-seq
MIRT1067373	hsa-miR-4281	CLIP-seq
MIRT1067374	hsa-miR-4449	CLIP-seq
MIRT1067375	hsa-miR-4459	CLIP-seq
MIRT1067376	hsa-miR-4530	CLIP-seq
MIRT1067377	hsa-miR-4722-5p	CLIP-seq
MIRT1067378	hsa-miR-761	CLIP-seq
MIRT1067379	hsa-miR-765	CLIP-seq
MIRT2016314	hsa-miR-4795-3p	CLIP-seq
MIRT2016315	hsa-miR-329	CLIP-seq
MIRT2016316	hsa-miR-362-3p	CLIP-seq
MIRT2248618	hsa-miR-3616-3p	CLIP-seq
MIRT2248619	hsa-miR-4779	CLIP-seq
MIRT1067375	hsa-miR-4459	CLIP-seq

Show/Hide all(54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004439	Function	Phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IEA
GO:0004445	Function	Inositol-polyphosphate 5-phosphatase activity	IDA	10764818
GO:0004445	Function	Inositol-polyphosphate 5-phosphatase activity	IEA
GO:0004445	Function	Inositol-polyphosphate 5-phosphatase activity	TAS	8769125
GO:0005515	Function	Protein binding	IPI	9148918, 9485206, 10382761, 15090612, 16339535, 19843936, 20933011, 21712384, 24642916, 25416956, 26221972, 26755705, 32296183
GO:0005737	Component	Cytoplasm	IDA	10822173
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006661	Process	Phosphatidylinositol biosynthetic process	IEA
GO:0006661	Process	Phosphatidylinositol biosynthetic process	TAS
GO:0006796	Process	Phosphate-containing compound metabolic process	TAS	8769125
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	8769125
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0009968	Process	Negative regulation of signal transduction	IBA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0016314	Function	Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0030853	Process	Negative regulation of granulocyte differentiation	IEA
GO:0030889	Process	Negative regulation of B cell proliferation	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0034485	Function	Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity	IEA
GO:0034485	Function	Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity	TAS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	36248894
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045579	Process	Positive regulation of B cell differentiation	IBA
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045621	Process	Positive regulation of lymphocyte differentiation	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0045656	Process	Negative regulation of monocyte differentiation	IEA
GO:0045659	Process	Negative regulation of neutrophil differentiation	IBA
GO:0045659	Process	Negative regulation of neutrophil differentiation	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045779	Process	Negative regulation of bone resorption	IBA
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	23154388
GO:0046856	Process	Phosphatidylinositol dephosphorylation	IEA
GO:0050776	Process	Regulation of immune response	IBA
GO:0050777	Process	Negative regulation of immune response	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050869	Process	Negative regulation of B cell activation	IEA
GO:0052659	Function	Inositol-1,3,4,5-tetrakisphosphate 5-phosphatase activity	IEA

MIM	HGNC	e!Ensembl
601582	6079	ENSG00000168918

Protein

UniProt ID

Q92835

Protein name

Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 (EC 3.1.3.86) (Inositol polyphosphate-5-phosphatase D) (EC 3.1.3.56) (Inositol polyphosphate-5-phosphatase of 145 kDa) (SIP-145) (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase) (EC 3.1.3.36) (

Protein function

Phosphatidylinositol (PtdIns) phosphatase that specifically hydrolyzes the 5-phosphate of phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3) to produce PtdIns(3,4)P2, thereby negatively regulating the PI3K (phosphoinositide 3-kinase) pat

PDB

2YSX , 5RW2 , 5RW3 , 5RW4 , 5RW5 , 5RW6 , 5RW7 , 5RW8 , 5RW9 , 5RWA , 5RWB , 5RWC , 5RWD , 5RWE , 5RWF , 5RWG , 5RWH , 5RWI , 5RWJ , 5RWK , 5RWL , 5RWM , 5RWN , 5RWO , 5RWP , 5RWQ , 5RWR , 5RWS , 5RWT , 5RWU , 5RWV , 5RWW , 5RWX , 5RWY , 5RWZ , 5RX0 , 5RX1 , 5RX2 , 5RX3 , 5RX4 , 5RX5 , 5RX6 , 5RX7 , 5RX8 , 5RX9 , 5RXA , 5RXB , 5RXC , 5RXD , 5RXE , 5RXF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	5 → 86	SH2 domain	Domain
PF03372	Exo_endo_phos	409 → 701	Endonuclease/Exonuclease/phosphatase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in immune and hematopoietic cells. Expressed in bone marrow and blood cells. Levels vary considerably within this compartment. Present in at least 74% of immature CD34+ cells, whereas within the more mature popul

Sequence

MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNED
DKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDTVESV
VSPPELPPRNIPLTASSCEAKEVPFSNENPRATETSRPSLSETLFQRLQSMDTSGLPEEH
LKAIQDYLSTQLAQDSEFVKTGSSSLPHLKKLTTLLCKELYGEVIRTLPSLESLQRLFDQ
QLSPGLRPRPQVPGEANPINMVSKLSQLTSLLSSIEDKVKALLHEGPESPHRPSLIPPVT
FEVKAESLGIPQKMQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVIL
VETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPK
KITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTV
AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNS
HLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAE
TIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQK
ATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKN
GPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKF
GETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHH
GELTGHFQGEIKLQTSQGKTREKLYDFVKTERDESSGPKTLKSLTSHDPMKQWEVTSRAP
PCSGSSITEIINPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGES
PPTPPGQPPISPKKFLPSTANRGLPPRTQESRPSDLGKNAGDTLPQEDLPLTKPEMFENP
LYGSLSSFPKPAPRKDQESPKMPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPA
PRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPR
PPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ

Sequence length

1189

Interactions

View interactions

	KEGG		Reactome
	Inositol phosphate metabolism Metabolic pathways Phosphatidylinositol signaling system B cell receptor signaling pathway Fc epsilon RI signaling pathway Fc gamma R-mediated phagocytosis		Synthesis of PIPs at the plasma membrane Synthesis of IP3 and IP4 in the cytosol Downstream TCR signaling PECAM1 interactions Interleukin receptor SHC signaling

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease, Alzheimer's disease or gastroesophageal reflux disease	N/A	N/A	GWAS
Coronary Heart Disease	Coronary heart disease	N/A	N/A	GWAS
Dementia	Dementia	N/A	N/A	GWAS
Dermatitis	Atopic dermatitis	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (38)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Coronary Syndrome	Associate	25319951
Alzheimer Disease	Associate	25114068, 28005991, 28199971, 31319229, 35139885, 36334414, 38016942
Alzheimer Disease	Stimulate	36981033
Carcinogenesis	Associate	19473701
Carcinoma Non Small Cell Lung	Associate	39176091
COVID 19	Associate	36334414
Crohn Disease	Associate	28767696
Cystic Fibrosis	Associate	21282106
Dermatitis Atopic	Associate	33901562
Diverticulitis	Associate	28619727
Fibrosis	Associate	28767696
Hemorrhage	Associate	23468366
Hepatitis C Chronic	Associate	21917890
Hypoxia	Associate	25961455
Ileitis	Associate	28767696
Inflammation	Inhibit	27463381
Inflammation	Associate	36923408, 39755217
Leukemia	Associate	35412895
Leukemia Lymphoma Adult T Cell	Associate	16217039, 19047050
Leukemia Myeloid Acute	Associate	15470047, 35412895
Leukemia T Cell	Associate	16351639
Liver Cirrhosis	Associate	21917890
Lung Neoplasms	Associate	39176091
Lymphoma T Cell	Associate	19473701
Multiple Sclerosis	Associate	23469041
Neoplasms	Inhibit	36958526
Neoplasms	Associate	39176091
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	15470047
Pancreatic Intraductal Neoplasms	Associate	27539223
Pneumonia	Associate	34758804, 36923408
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Inhibit	36958526
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	19473701
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	36958526
Sepsis	Associate	36923408
Squamous Cell Carcinoma of Head and Neck	Associate	27584795
Stroke	Associate	23468366
Tauopathies	Associate	33419465
Wiskott Aldrich Syndrome	Associate	27330000

INPP5D (inositol polyphosphate-5-phosphatase D)