Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3631
Gene name Gene Name - the full gene name approved by the HGNC.
Inositol polyphosphate-4-phosphatase type I A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
INPP4A
Synonyms (NCBI Gene) Gene synonyms aliases
INPP4, TVAS1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an Mg++ independent enzyme that hydrolyzes the 4-position phosphate from the inositol ring of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate, and inositol 3,4-bisphosphate. Multiple transcript variants encoding disti
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1306444586 C>T Likely-pathogenic Non coding transcript variant, upstream transcript variant, synonymous variant, coding sequence variant, genic upstream transcript variant
rs1574887674 C>T Pathogenic Coding sequence variant, intron variant, non coding transcript variant, stop gained, genic upstream transcript variant, upstream transcript variant
rs1574965220 TC>- Likely-pathogenic Frameshift variant, non coding transcript variant, coding sequence variant, genic upstream transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT046283 hsa-miR-23b-3p CLASH 23622248
MIRT039407 hsa-miR-421 CLASH 23622248
MIRT037226 hsa-miR-877-5p CLASH 23622248
MIRT037226 hsa-miR-877-5p CLASH 23622248
MIRT036040 hsa-miR-1301-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25869668
GO:0005634 Component Nucleus IDA 30071275
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600916 6074 ENSG00000040933
Protein
UniProt ID Q96PE3
Protein name Inositol polyphosphate-4-phosphatase type I A (Inositol polyphosphate 4-phosphatase type I) (Type I inositol 3,4-bisphosphate 4-phosphatase) (EC 3.1.3.66)
Protein function Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) (PubMed:15716355, PubMed:20463662). Also catalyzes inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate (By similarity). Antagoni
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is expressed in the platelets, MEG-01 megakaryocytes and Jurkat T-cells. Isoform 2 is expressed in the brain. {ECO:0000269|PubMed:11485317}.
Sequence
MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSL
DRKPNSFVAVSVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVY
DVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQR
PPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDTLLKSVFGGAICRMYRFPTTDG
NHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEELGELSPCWESLRRQIVTQYQT
IILTYQENLTDLHQYRGPSFKASSLKADKKLEFVPTNLHIQRMRVQDDGGSDQNYDIVTI
GAPAAHCQGFKSGGLRKKLHKFEETKKHFEECCTSSGCQSIIYIPQDVVRAKEIIAQINT
LKTQVSYYAERLSRAAKDRSATGLERTLAILADKTRQLVTVCDCKLLANSIHGLNAARPD
YIASKASPTSTEEEQVMLRNDQDTLMARWTGRNSRSSLQVDWHEEEWEKVWLNVDKSLEC
IIQRVDKLLQKERLHGEGCEDVFPCAGSCTSKKGNPDSHAYWIRPEDPFCDVPSSPCPST
MPSTACHPHLTTHCSPPPEESSPGEWSEALYPLLTTLTDCVAMMSDKAKKAMVFLLMQDS
APTIATYLSLQYRRDVVFCQTLTALICGFIIKLRNCLHDDGFLRQLYTIGLLAQFESLLS
TYGEELAMLEDMSLGIMDLRNVTFKVTQATSSASADMLPVITGNRDGFNVRVPLPGPLFD
ALPREIQSGMLLRVQPVLFNVGINEQQTLAERFGDTSLQEVINVESLVRLNSYFEQFKEV
LPEDCLPRSRSQTCLPELLRFLGQNVHARKNKNVDILWQAAEICRRLNGVRFTSCKSAKD
RTAMSVTLEQCLILQHEHGMAPQVFTQALECMRSEGCRRENTMKNVGSRKYAFNSLQLKA
FPKHYRPPEGTYGKVET
Sequence length 977
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
  Synthesis of PIPs at the plasma membrane
Synthesis of PIPs at the early endosome membrane
Synthesis of IP2, IP, and Ins in the cytosol
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Dyskeratosis Congenita dyskeratosis congenita, autosomal dominant 1 rs1306444586 N/A
Mental retardation intellectual disability rs1574887674 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Neurodevelopmental Disorders neurodevelopmental disorder N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Pancreatic Ductal Associate 35856354
Carcinoma Renal Cell Associate 29415082
Colorectal Neoplasms Associate 30809968
Diabetes Mellitus Type 1 Associate 34006268
Neoplasms Associate 28337959
Pancreatic Intraductal Neoplasms Associate 28776573
Pancreatic Neoplasms Associate 27733216, 29415082
Urinary Bladder Neoplasms Associate 28337959