Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3628
Gene name Gene Name - the full gene name approved by the HGNC.	Inositol polyphosphate-1-phosphatase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	INPP1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q32.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisp

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments
MIRT1067106	hsa-miR-128	CLIP-seq
MIRT1067107	hsa-miR-27a	CLIP-seq
MIRT1067108	hsa-miR-27b	CLIP-seq
MIRT1067109	hsa-miR-4328	CLIP-seq
MIRT1067110	hsa-miR-513a-5p	CLIP-seq

Show/Hide all(9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004441	Function	Inositol-1,4-bisphosphate 1-phosphatase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	26871637
GO:0005829	Component	Cytosol	TAS
GO:0006796	Process	Phosphate-containing compound metabolic process	TAS	8390685
GO:0007165	Process	Signal transduction	TAS	8390685
GO:0043647	Process	Inositol phosphate metabolic process	TAS
GO:0046854	Process	Phosphatidylinositol phosphorylation	IEA
GO:0046855	Process	Inositol phosphate dephosphorylation	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
147263	6071	ENSG00000151689

Protein

UniProt ID

P49441

Protein name

Inositol polyphosphate 1-phosphatase (IPP) (IPPase) (EC 3.1.3.57)

Protein function

Mg(2+)-dependent phosphatase that catalyzes the hydrolysis of the 1-position phosphate from inositol 1,4-bisphosphate and inositol 1,3,4-trisphosphate and participates in inositol phosphate metabolism.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00459	Inositol_P	74 → 381	Inositol monophosphatase family	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with highest levels in pancreas and kidney.

Sequence

MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEV
IKQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEA
LARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQ
CVTILIGVYDIQTGVPLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRR
NGSETHTGNTGSEAAFSPSFSAVISTSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQG
LVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGA
AGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT

Sequence length

399

Interactions

View interactions

	KEGG		Reactome
	Inositol phosphate metabolism Metabolic pathways Phosphatidylinositol signaling system		Synthesis of IP2, IP, and Ins in the cytosol

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	14627686

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Cell Transformation Neoplastic	Associate	31557403
Uterine Cervical Neoplasms	Associate	31557403

INPP1 (inositol polyphosphate-1-phosphatase)