INHBC (inhibin subunit beta C)

Gene

• Entrez ID: 3626
• Gene name: Inhibin subunit beta C
• Gene symbol: INHBC
• Synonyms (NCBI Gene): IHBC
• Chromosome: 12
• Chromosome location: 12q13.3
• Summary: This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of homodimeric and heterodimeric activin complexes. The heterodimeric comple

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1066645	hsa-miR-3653	CLIP-seq
MIRT1066646	hsa-miR-4283	CLIP-seq
MIRT1066647	hsa-miR-4284	CLIP-seq
MIRT1066648	hsa-miR-4305	CLIP-seq
MIRT1066649	hsa-miR-4437	CLIP-seq
MIRT1066650	hsa-miR-549	CLIP-seq
MIRT2015985	hsa-miR-128	CLIP-seq
MIRT2015986	hsa-miR-183	CLIP-seq
MIRT2015987	hsa-miR-4426	CLIP-seq
MIRT2015988	hsa-miR-4647	CLIP-seq
MIRT2015989	hsa-miR-4662b	CLIP-seq
MIRT2451854	hsa-miR-1275	CLIP-seq
MIRT2451855	hsa-miR-3179	CLIP-seq
MIRT2451856	hsa-miR-3202	CLIP-seq
MIRT2451857	hsa-miR-3936	CLIP-seq
MIRT2451858	hsa-miR-4271	CLIP-seq
MIRT2451859	hsa-miR-4525	CLIP-seq
MIRT2451860	hsa-miR-4665-5p	CLIP-seq
MIRT2451861	hsa-miR-4723-5p	CLIP-seq
MIRT2451862	hsa-miR-4725-3p	CLIP-seq
MIRT2451863	hsa-miR-4747-5p	CLIP-seq
MIRT2451864	hsa-miR-625	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005160	Function	Transforming growth factor beta receptor binding	TAS	7826378
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	TAS	7826378
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0008083	Function	Growth factor activity	IEA
GO:0010862	Process	Positive regulation of pathway-restricted SMAD protein phosphorylation	IBA	21873635
GO:0060395	Process	SMAD protein signal transduction	IBA	21873635

Other IDs

• MIM: 601233
• HGNC: 6068
• e!Ensembl: ENSG00000175189

Protein

• UniProt ID: P55103
• Protein name: Inhibin beta C chain (Activin beta-C chain)
• Protein function: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonad
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00019	TGF_beta	246 → 351	Transforming growth factor beta like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in benign prostatic hyperplasia. {ECO:0000269|PubMed:9428386}.
• Sequence:

  MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQR
  PTLNRPVSRAALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSS
  DRTAGDREVQQASLMFFVQLPSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQL
  PLGPEAQAACSQGHLTLELVLEGQVAQSSVILGGAAHRPFVAARVRVGGKHQIHRRGIDC
  QGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLN
  LLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

• Sequence length: 352

Pathways

KEGG:

Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells

Reactome:

Glycoprotein hormones

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Kidney Disease	Kidney Disease			GWAS
Gout	Gout			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Diabetic Nephropathies	Associate	30988245
Gout	Associate	26427508
Hydatidiform Mole	Associate	17649811
Neoplasm Metastasis	Associate	23284751