INHBC (inhibin subunit beta C)

Gene

• Entrez ID: 3626
• Gene name: Inhibin subunit beta C
• Gene symbol: INHBC
• Synonyms (NCBI Gene): IHBC
• Chromosome: 12
• Chromosome location: 12q13.3
• Summary: This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of homodimeric and heterodimeric activin complexes. The heterodimeric comple

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1066645	hsa-miR-3653	CLIP-seq
MIRT1066646	hsa-miR-4283	CLIP-seq
MIRT1066647	hsa-miR-4284	CLIP-seq
MIRT1066648	hsa-miR-4305	CLIP-seq
MIRT1066649	hsa-miR-4437	CLIP-seq
MIRT1066650	hsa-miR-549	CLIP-seq
MIRT2015985	hsa-miR-128	CLIP-seq
MIRT2015986	hsa-miR-183	CLIP-seq
MIRT2015987	hsa-miR-4426	CLIP-seq
MIRT2015988	hsa-miR-4647	CLIP-seq
MIRT2015989	hsa-miR-4662b	CLIP-seq
MIRT2451854	hsa-miR-1275	CLIP-seq
MIRT2451855	hsa-miR-3179	CLIP-seq
MIRT2451856	hsa-miR-3202	CLIP-seq
MIRT2451857	hsa-miR-3936	CLIP-seq
MIRT2451858	hsa-miR-4271	CLIP-seq
MIRT2451859	hsa-miR-4525	CLIP-seq
MIRT2451860	hsa-miR-4665-5p	CLIP-seq
MIRT2451861	hsa-miR-4723-5p	CLIP-seq
MIRT2451862	hsa-miR-4725-3p	CLIP-seq
MIRT2451863	hsa-miR-4747-5p	CLIP-seq
MIRT2451864	hsa-miR-625	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005160	Function	Transforming growth factor beta receptor binding	TAS	7826378
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	7826378
GO:0005615	Component	Extracellular space	IBA
GO:0007178	Process	Cell surface receptor protein serine/threonine kinase signaling pathway	IBA
GO:0008083	Function	Growth factor activity	IEA

Other IDs

• MIM: 601233
• HGNC: 6068
• e!Ensembl: ENSG00000175189

Protein

• UniProt ID: P55103
• Protein name: Inhibin beta C chain (Activin beta-C chain)
• Protein function: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonad
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00019	TGF_beta	246 → 351	Transforming growth factor beta like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in benign prostatic hyperplasia. {ECO:0000269|PubMed:9428386}.
• Sequence:

  MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQR
  PTLNRPVSRAALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSS
  DRTAGDREVQQASLMFFVQLPSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQL
  PLGPEAQAACSQGHLTLELVLEGQVAQSSVILGGAAHRPFVAARVRVGGKHQIHRRGIDC
  QGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLN
  LLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

• Sequence length: 352

Pathways

KEGG:

Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells

Reactome:

Glycoprotein hormones

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Gout	Gout	N/A	N/A	GWAS
Kidney Disease	Chronic kidney disease	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Diabetic Nephropathies	Associate	30988245
Gout	Associate	26427508
Hydatidiform Mole	Associate	17649811
Neoplasm Metastasis	Associate	23284751