Gene Gene information from NCBI Gene database.
Entrez ID 3626
Gene name Inhibin subunit beta C
Gene symbol INHBC
Synonyms (NCBI Gene)
IHBC
Chromosome 12
Chromosome location 12q13.3
Summary This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of homodimeric and heterodimeric activin complexes. The heterodimeric comple
miRNA miRNA information provided by mirtarbase database.
22
miRTarBase ID miRNA Experiments Reference
MIRT1066645 hsa-miR-3653 CLIP-seq
MIRT1066646 hsa-miR-4283 CLIP-seq
MIRT1066647 hsa-miR-4284 CLIP-seq
MIRT1066648 hsa-miR-4305 CLIP-seq
MIRT1066649 hsa-miR-4437 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IBA
GO:0005160 Function Transforming growth factor beta receptor binding TAS 7826378
GO:0005179 Function Hormone activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS 7826378
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601233 6068 ENSG00000175189
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P55103
Protein name Inhibin beta C chain (Activin beta-C chain)
Protein function Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonad
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00019 TGF_beta 246 351 Transforming growth factor beta like domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in benign prostatic hyperplasia. {ECO:0000269|PubMed:9428386}.
Sequence
MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQR
PTLNRPVSRAALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSS
DRTAGDREVQQASLMFFVQLPSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQL
PLGPEAQAACSQGHLTLELVLEGQVAQSSVILGGAAHRPFVAARVRVGGKHQIHRRGIDC
QGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLN
LLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGC
S
Sequence length 352
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells
  Glycoprotein hormones