INHA (inhibin subunit alpha)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 3623
Gene name Inhibin subunit alpha
Gene symbol INHA
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2q35
Summary This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate multiple peptide products, including the alpha subunit of the inhibin A and B protein
miRNA miRNA information provided by mirtarbase database.
12
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (12)
miRTarBase ID miRNA Experiments Reference
MIRT029233 hsa-miR-26b-5p Microarray 19088304
MIRT1066437 hsa-miR-3150a-3p CLIP-seq
MIRT1066438 hsa-miR-3175 CLIP-seq
MIRT1066439 hsa-miR-342-5p CLIP-seq
MIRT1066440 hsa-miR-4461 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
47
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (47)
GO ID Ontology Definition Evidence Reference
GO:0001501 Process Skeletal system development TAS 10865214
GO:0001541 Process Ovarian follicle development IEA
GO:0001541 Process Ovarian follicle development NAS 9166111
GO:0001750 Component Photoreceptor outer segment IEA
GO:0001917 Component Photoreceptor inner segment IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
147380 6065 ENSG00000123999
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P05111
Protein name Inhibin alpha chain
Protein function Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonad
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00019 TGF_beta 261 → 365 Transforming growth factor beta like domain Domain
Tissue specificity TISSUE SPECIFICITY: Originally found in ovary (granulosa cells) and testis (Sertoli cells), but widely distributed in many tissues including brain and placenta. In adrenal cortex expression is limited to the zona reticularis and the innermost zona fascicu
Sequence 
MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPR
RHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQH
TRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLH
LATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWP
WSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP
PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLT
QHCACI
Sequence length 366
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cytokine-cytokine receptor interaction   Glycoprotein hormones
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
8
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
INHA-related disorder Likely benign; Benign rs371366906, rs12720063, rs140014760, rs12720062 RCV003974100
RCV003972050
RCV003963849
RCV003912792
Premature ovarian failure Benign; Likely benign rs12720062 RCV001258300
Uterine carcinosarcoma Uncertain significance rs35118453 RCV005900403
Show/Hide Text Mining Associations (24)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34887858, 37543671
Adrenal Cortex Neoplasms Associate 15121773, 25111790
Adrenocortical Carcinoma Associate 23866946, 25111790
Aicardi Syndrome Associate 25111790
Azoospermia Associate 35235537
Breast Neoplasms Associate 33819300
Carcinogenesis Associate 23866946
Carcinoma Ovarian Epithelial Associate 12366660, 24302632
Carcinoma Renal Cell Associate 35945780
Cystadenoma Papillary Associate 24302632