Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3604
Gene name Gene Name - the full gene name approved by the HGNC.
TNF receptor superfamily member 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFRSF9
Synonyms (NCBI Gene) Gene synonyms aliases
4-1BB, CD137, CDw137, ILA, IMD109
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.23
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induc
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017048 hsa-miR-335-5p Microarray 18185580
MIRT027444 hsa-miR-98-5p Microarray 19088304
MIRT613861 hsa-miR-1226-3p HITS-CLIP 19536157
MIRT613860 hsa-miR-4733-3p HITS-CLIP 19536157
MIRT613859 hsa-miR-4267 HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
NFKB1 Unknown 12706838
RELA Unknown 12706838
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 8262389
GO:0006915 Process Apoptotic process IEA
GO:0006915 Process Apoptotic process TAS 8639902
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602250 11924 ENSG00000049249
Protein
UniProt ID Q07011
Protein name Tumor necrosis factor receptor superfamily member 9 (4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137)
Protein function Receptor for TNFSF9/4-1BBL. Conveys a signal that enhances CD8(+) T-cell survival, cytotoxicity, and mitochondrial activity, thereby promoting immunity against viruses and tumors (Probable).
PDB 6A3V , 6A3W , 6BWV , 6CPR , 6CU0 , 6MGP , 6MHR , 6MI2 , 6Y8K , 7D4B , 7YXU , 8GYE , 8OZ3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 48 86 TNFR/NGFR cysteine-rich region Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on the surface of activated T-cells. {ECO:0000269|PubMed:30872117}.
Sequence
MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQR
TCDICRQCKGVFRTRKECSSTSNAEC
DCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDC
CFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPARE
PGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDG
CSCRFPEEEEGGCEL
Sequence length 255
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 22282196
Alveolar Bone Loss Associate 34385358
Arthritis Rheumatoid Associate 28681901, 31875586, 33800462, 9485208
Arthritis Rheumatoid Inhibit 35812455
Atherosclerosis Associate 25032953
Autoimmune Diseases Associate 18519814, 28347235
Berylliosis Associate 18768897
Brain Injuries Associate 29697202
Breast Neoplasms Associate 27831501
Breast Neoplasms Stimulate 39351539