Gene Gene information from NCBI Gene database.
Entrez ID 3604
Gene name TNF receptor superfamily member 9
Gene symbol TNFRSF9
Synonyms (NCBI Gene)
4-1BBCD137CDw137ILAIMD109
Chromosome 1
Chromosome location 1p36.23
Summary The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induc
miRNA miRNA information provided by mirtarbase database.
659
miRTarBase ID miRNA Experiments Reference
MIRT017048 hsa-miR-335-5p Microarray 18185580
MIRT027444 hsa-miR-98-5p Microarray 19088304
MIRT613861 hsa-miR-1226-3p HITS-CLIP 19536157
MIRT613860 hsa-miR-4733-3p HITS-CLIP 19536157
MIRT613859 hsa-miR-4267 HITS-CLIP 19536157
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
NFKB1 Unknown 12706838
RELA Unknown 12706838
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 8262389
GO:0006915 Process Apoptotic process IEA
GO:0006915 Process Apoptotic process TAS 8639902
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602250 11924 ENSG00000049249
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07011
Protein name Tumor necrosis factor receptor superfamily member 9 (4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137)
Protein function Receptor for TNFSF9/4-1BBL. Conveys a signal that enhances CD8(+) T-cell survival, cytotoxicity, and mitochondrial activity, thereby promoting immunity against viruses and tumors (Probable).
PDB 6A3V , 6A3W , 6BWV , 6CPR , 6CU0 , 6MGP , 6MHR , 6MI2 , 6Y8K , 7D4B , 7YXU , 8GYE , 8OZ3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 48 86 TNFR/NGFR cysteine-rich region Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on the surface of activated T-cells. {ECO:0000269|PubMed:30872117}.
Sequence
MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQR
TCDICRQCKGVFRTRKECSSTSNAEC
DCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDC
CFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPARE
PGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDG
CSCRFPEEEEGGCEL
Sequence length 255
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
18
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Lymphoma Pathogenic rs754024907 RCV005925552
Squamous cell carcinoma of the head and neck Pathogenic rs754024907 RCV005925551
TNFRSF9-related disorder Likely pathogenic; Pathogenic rs1639761448 RCV002291303
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Colorectal cancer Uncertain significance; Benign rs375937837, rs767796238 RCV005868533
RCV005868601
Familial cancer of breast Benign rs767796238 RCV005868599
Immunodeficiency 109 with lymphoproliferation Uncertain significance rs1280784319, rs556537043, rs2527270851 RCV005397196
RCV005025565
RCV003152819
Malignant lymphoma, large B-cell, diffuse Benign rs767796238 RCV005868600
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 22282196
Alveolar Bone Loss Associate 34385358
Arthritis Rheumatoid Associate 28681901, 31875586, 33800462, 9485208
Arthritis Rheumatoid Inhibit 35812455
Atherosclerosis Associate 25032953
Autoimmune Diseases Associate 18519814, 28347235
Berylliosis Associate 18768897
Brain Injuries Associate 29697202
Breast Neoplasms Associate 27831501
Breast Neoplasms Stimulate 39351539