Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	359787
Gene name Gene Name - the full gene name approved by the HGNC.	Developmental pluripotency associated 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DPPA3
Synonyms (NCBI Gene) Gene synonyms aliases	Pgc7, STELLA
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that in mice may function as a maternal factor during the preimplantation stage of development. In mice, this gene may play a role in transcriptional repression, cell division, and maintenance of cell pluripotentiality. In huma

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments
MIRT944364	hsa-miR-4732-5p	CLIP-seq
MIRT944365	hsa-miR-4762-5p	CLIP-seq
MIRT944366	hsa-miR-561	CLIP-seq
MIRT944367	hsa-miR-610	CLIP-seq
MIRT944368	hsa-miR-936	CLIP-seq
MIRT944365	hsa-miR-4762-5p	CLIP-seq
MIRT2214686	hsa-miR-488	CLIP-seq
MIRT2214687	hsa-miR-9	CLIP-seq
MIRT2679451	hsa-miR-1587	CLIP-seq
MIRT2679452	hsa-miR-4263	CLIP-seq
MIRT2679453	hsa-miR-4420	CLIP-seq
MIRT2679454	hsa-miR-4674	CLIP-seq

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001939	Component	Female pronucleus	ISS
GO:0001940	Component	Male pronucleus	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21421998
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	21421998
GO:0005737	Component	Cytoplasm	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0044726	Process	Epigenetic programing of female pronucleus	IBA
GO:0044726	Process	Epigenetic programing of female pronucleus	ISS
GO:0062072	Function	Histone H3K9me2/3 reader activity	ISS

MIM	HGNC	e!Ensembl
608408	19199	ENSG00000187569

Protein

UniProt ID

Q6W0C5

Protein name

Developmental pluripotency-associated protein 3 (Stella-related protein)

Protein function

Primordial germ cell (PGCs)-specific protein involved in epigenetic chromatin reprogramming in the zygote following fertilization (PubMed:35314832). In zygotes, DNA demethylation occurs selectively in the paternal pronucleus before the first cel

PDB

8WMS , 8XV7 , 8XV8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15549	PGC7_Stella	1 → 155	PGC7/Stella/Dppa3 domain	Family

Tissue specificity

TISSUE SPECIFICITY: Low expression in testis, ovary and thymus. Expressed in embryonic stem and carcinoma cells. Highly expressed in testicular germ cell tumors. {ECO:0000269|PubMed:14654002, ECO:0000269|PubMed:14684992, ECO:0000269|PubMed:14990856}.

Sequence

MDPSQFNPTYIPGSPQMLTEENSRDDSGASQISSETLIKNLSNLTINASSESVSPLSEAL
LRRESVGAAVLREIEDEWLYSRRGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNKEPK
GVKKESRPFKCPCSFCVSNGWDPSENARIGNQDTKPLQP

Sequence length

159

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Borderline personality disorder	Borderline personality disorder	N/A	N/A	GWAS
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Lesch Nyhan Syndrome	Associate	40710358
Testicular Germ Cell Tumor	Associate	27803193, 37508506

DPPA3 (developmental pluripotency associated 3)