Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3587
Gene name	Interleukin 10 receptor subunit alpha
Gene symbol	IL10RA
Synonyms (NCBI Gene)	CD210CD210aCDW210AHIL-10RIL-10R1IL10R
Chromosome	11
Chromosome location	11q23.3
Summary	The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammator

Show/Hide all (14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853579	G>A,C	Pathogenic	Coding sequence variant, non coding transcript variant, 5 prime UTR variant, missense variant
rs137853580	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, intron variant, missense variant
rs138929400	T>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, non coding transcript variant, missense variant
rs148808529	T>C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Non coding transcript variant, synonymous variant, coding sequence variant
rs149491038	C>T	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs199604463	G>A	Conflicting-interpretations-of-pathogenicity	Non coding transcript variant, coding sequence variant, synonymous variant
rs201396764	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Non coding transcript variant, coding sequence variant, missense variant
rs201643277	A>G	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Non coding transcript variant, coding sequence variant, 5 prime UTR variant, missense variant
rs368287711	C>A,T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant, synonymous variant, intron variant
rs377525753	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	5 prime UTR variant, synonymous variant, coding sequence variant, non coding transcript variant
rs560128585	A>C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	5 prime UTR variant, synonymous variant, coding sequence variant, non coding transcript variant
rs1192830343	C>T	Likely-pathogenic	Stop gained, non coding transcript variant, coding sequence variant
rs1419560997	G>A	Pathogenic	Synonymous variant, coding sequence variant, non coding transcript variant
rs1591263883	C>T	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT491524	hsa-miR-556-5p	PAR-CLIP	23592263
MIRT491523	hsa-miR-548q	PAR-CLIP	23592263
MIRT491522	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT491521	hsa-miR-558	PAR-CLIP	23592263
MIRT491520	hsa-miR-4487	PAR-CLIP	23592263
MIRT491519	hsa-miR-6089	PAR-CLIP	23592263
MIRT491518	hsa-miR-138-5p	PAR-CLIP	23592263
MIRT491517	hsa-miR-483-3p	PAR-CLIP	23592263
MIRT491516	hsa-miR-8064	PAR-CLIP	23592263
MIRT491524	hsa-miR-556-5p	PAR-CLIP	23592263
MIRT491523	hsa-miR-548q	PAR-CLIP	23592263
MIRT491522	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT491521	hsa-miR-558	PAR-CLIP	23592263
MIRT491520	hsa-miR-4487	PAR-CLIP	23592263
MIRT491519	hsa-miR-6089	PAR-CLIP	23592263
MIRT491518	hsa-miR-138-5p	PAR-CLIP	23592263
MIRT491517	hsa-miR-483-3p	PAR-CLIP	23592263
MIRT491516	hsa-miR-8064	PAR-CLIP	23592263
MIRT1063473	hsa-miR-1184	CLIP-seq
MIRT1063474	hsa-miR-1205	CLIP-seq
MIRT1063475	hsa-miR-1208	CLIP-seq
MIRT1063476	hsa-miR-1237	CLIP-seq
MIRT1063477	hsa-miR-1238	CLIP-seq
MIRT1063478	hsa-miR-1913	CLIP-seq
MIRT1063479	hsa-miR-1915	CLIP-seq
MIRT1063480	hsa-miR-19a	CLIP-seq
MIRT1063481	hsa-miR-19b	CLIP-seq
MIRT1063482	hsa-miR-214	CLIP-seq
MIRT1063483	hsa-miR-3158-5p	CLIP-seq
MIRT1063484	hsa-miR-3189-5p	CLIP-seq
MIRT1063485	hsa-miR-3194-3p	CLIP-seq
MIRT1063486	hsa-miR-324-3p	CLIP-seq
MIRT1063487	hsa-miR-3619-5p	CLIP-seq
MIRT1063488	hsa-miR-4283	CLIP-seq
MIRT1063489	hsa-miR-4291	CLIP-seq
MIRT1063490	hsa-miR-4314	CLIP-seq
MIRT1063491	hsa-miR-4420	CLIP-seq
MIRT1063492	hsa-miR-4489	CLIP-seq
MIRT1063493	hsa-miR-4667-5p	CLIP-seq
MIRT1063494	hsa-miR-4675	CLIP-seq
MIRT1063495	hsa-miR-4700-5p	CLIP-seq
MIRT1063496	hsa-miR-4711-3p	CLIP-seq
MIRT1063497	hsa-miR-4727-5p	CLIP-seq
MIRT1063498	hsa-miR-4741	CLIP-seq
MIRT1063499	hsa-miR-4758-3p	CLIP-seq
MIRT1063500	hsa-miR-4769-3p	CLIP-seq
MIRT1063501	hsa-miR-637	CLIP-seq
MIRT1063502	hsa-miR-660	CLIP-seq
MIRT1063503	hsa-miR-761	CLIP-seq
MIRT1063504	hsa-miR-922	CLIP-seq
MIRT1063475	hsa-miR-1208	CLIP-seq
MIRT1063480	hsa-miR-19a	CLIP-seq
MIRT1063481	hsa-miR-19b	CLIP-seq
MIRT1063491	hsa-miR-4420	CLIP-seq
MIRT2247343	hsa-miR-493	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004920	Function	Interleukin-10 receptor activity	IBA
GO:0004920	Function	Interleukin-10 receptor activity	IDA	16982608, 24367025
GO:0004920	Function	Interleukin-10 receptor activity	IEA
GO:0004920	Function	Interleukin-10 receptor activity	TAS	8120391
GO:0005515	Function	Protein binding	IPI	11485736, 12093920, 12513909, 15837194, 16982608, 18395809, 20462497, 22087322, 24008843, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	16982608
GO:0005886	Component	Plasma membrane	IDA	22087322
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8407942
GO:0005929	Component	Cilium	IDA
GO:0010507	Process	Negative regulation of autophagy	IDA	26962683
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	22087322
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019969	Function	Interleukin-10 binding	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0038023	Function	Signaling receptor activity	TAS	8407942
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	16982608
GO:0050728	Process	Negative regulation of inflammatory response	IDA	24367025
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0060729	Process	Intestinal epithelial structure maintenance	IDA	29454749
GO:0070086	Process	Ubiquitin-dependent endocytosis	IDA	22087322
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	7543512, 16982608
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	16982608

MIM	HGNC	e!Ensembl
146933	5964	ENSG00000110324

Q13651

Protein name

Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)

Protein function

Cell surface receptor for the cytokine IL10 that participates in IL10-mediated anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Upon binding to IL10, induces a conformational change in IL10RB, allowing IL

PDB

1J7V , 1LQS , 1Y6K , 1Y6M , 1Y6N , 5IXI , 6X93

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01108	Tissue_fac	4 → 111	Tissue factor	Family

Tissue specificity

TISSUE SPECIFICITY: Primarily expressed in hematopoetic cells including B-cells, T-cells, NK cells, monocytes and macrophages. Not expressed in non-hematopoetic cells such as fibroblasts or endothelial cells.

Sequence

MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVA
LLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSV
DEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTF
THKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTNVIIFF
AFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEA
FLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSC
SSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGS
ALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRC
LVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWS
FAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE

Sequence length

578

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor JAK-STAT signaling pathway Toxoplasmosis Tuberculosis Human cytomegalovirus infection		Interleukin-10 signaling

421

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
IL10RA-related disorder	Likely pathogenic; Pathogenic	rs368287711	RCV003398584
Inflammatory bowel disease 28	Pathogenic; Likely pathogenic	rs2134991615, rs1187971271, rs1214626558, rs1414190221, rs1027503096, rs1415553044, rs2496780587, rs2058036751, rs759537444, rs137853579, rs137853580, rs149491038, rs368287711, rs1192830343, rs1419560997, rs1591263883, rs369219156 View all (2 more)	RCV001387734 RCV001972249 RCV001974279 RCV001966719 RCV003037432 RCV002775181 RCV002852849 RCV003527027 RCV003527589 RCV000015937 RCV000015938 RCV000032625 RCV000032627 RCV000988744 RCV001030031 RCV001030032 RCV001214188

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Familial cancer of breast	Conflicting classifications of pathogenicity	rs758480654	RCV005931757
Inflammatory bowel disease	Likely benign	rs146951811	RCV000315577

Show/Hide Text Mining Associations (101)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abscess	Associate	33849446
Acquired Immunodeficiency Syndrome	Associate	20531015, 20976276
Adenocarcinoma	Associate	23280621
Anal Gland Neoplasms	Associate	30365510, 33849446
Arthritis	Associate	22550014
Arthritis Rheumatoid	Associate	16859503
Arthritis Rheumatoid	Inhibit	36614150
Calculi	Associate	39943638
Carcinoma Giant Cell	Associate	21196886
Carcinoma Non Small Cell Lung	Associate	10997808
Carcinoma Ovarian Epithelial	Associate	30485902
Carcinoma Renal Cell	Associate	18344594
Carcinoma Squamous Cell	Associate	36703911
Carotid Artery Diseases	Associate	37861500
Castleman Disease	Associate	32303241
Chlamydial Pneumonia	Associate	28440293
Chronic Periodontitis	Associate	30922293
Colitis	Associate	19890111, 33405352
Colitis Ulcerative	Associate	22550014, 24379584, 33405352
Common Variable Immunodeficiency	Associate	18254984
Coronary Artery Disease	Associate	36077487
COVID 19	Associate	37442134
Crohn Disease	Associate	31889944, 32587451, 35311452
Cystic Fibrosis	Associate	18026571
Cytomegalovirus Infections	Associate	28501927
Cytomegalovirus Retinitis	Associate	20617924
Dermatitis Atopic 1	Associate	20232770
Diabetic Nephropathies	Associate	35909518
Diarrhea	Associate	33849446
Disease	Associate	27302973
Drug Hypersensitivity	Associate	37861500
Dysbiosis	Associate	32587451
Enterocolitis	Associate	19890111
Erythema Nodosum	Associate	32034084
Fatigue Syndrome Chronic	Associate	16049284
Fever	Associate	32303241
Fistula	Associate	33849446
Glucosephosphate Dehydrogenase Deficiency	Associate	32630408
Granuloma Giant Cell	Associate	21196886
Hashimoto Disease	Associate	37511050
Hematologic Diseases	Associate	26822028
Hepatitis C Chronic	Associate	24081683
HIV Infections	Associate	20976276, 31507593
Hypereosinophilic Syndrome	Associate	36077487
Idiopathic Pulmonary Fibrosis	Associate	15809201
Immune System Diseases	Associate	37325673
Immunologic Deficiency Syndromes	Associate	22550014
Inflammation	Associate	25056661, 29504848, 36077487
Inflammation	Inhibit	27091721
Inflammatory Bowel Disease 25 Autosomal Recessive	Associate	26193622, 27350736, 33849446, 34730757, 34908808, 37986047
Inflammatory Bowel Disease 28 Autosomal Recessive	Associate	31648101
Inflammatory Bowel Diseases	Associate	19890111, 22550014, 24001973, 24089328, 26822028, 27350736, 27903283, 28082818, 30365510, 31648101, 32117262, 32351297, 32587451, 32925557, 33505153 View all (6 more)
Inflammatory Bowel Diseases	Inhibit	31417161
Kidney Diseases	Associate	38174742
Leukemia Myelomonocytic Juvenile	Associate	26822028
Light Fixation Seizure Syndrome	Associate	33505153
Liver Diseases	Associate	20531015
Liver Failure Acute	Associate	36308662
Liver Neoplasms	Stimulate	26301107
Lupus Erythematosus Systemic	Associate	21635228, 37511050
Lupus Nephritis	Inhibit	21635228
Lymphoma B Cell	Associate	22649007, 24089328
Lymphoma Large B Cell Diffuse	Associate	24089328, 34858727
Lymphoma Large Cell Anaplastic	Associate	32573700
Lymphoma Non Hodgkin	Associate	22649007
Malignant Teratocarcinosarcoma	Associate	24741599
Melanoma	Associate	14726694, 23921087, 25720800, 26631117
Migraine Disorders	Inhibit	27091721
Mitochondrial Diseases	Associate	16049284
Mucocutaneous Lymph Node Syndrome	Associate	36077487
Multiple Myeloma	Associate	11122145
Multiple Sclerosis	Associate	18200504
Multiple Sclerosis Relapsing Remitting	Inhibit	35416319
Nasal Polyps	Associate	24741599, 36466903
Neoplasm Metastasis	Associate	18344594
Neoplasms	Associate	25056661, 25720800, 34858727, 35874683, 37005667, 39325190
Nevus	Associate	14726694
Obesity	Associate	28903065
Oral Ulcer	Associate	31889944
Ovarian Neoplasms	Associate	20430716, 37800814
Pancreatic Neoplasms	Associate	33845841
Platelet Signal Processing Defect	Associate	37986047
Pleural Effusion Malignant	Associate	39325190
Pneumonia	Associate	37861500
Preauricular Tag Isolated Autosomal Dominant 1	Associate	33849446
Primary Immunodeficiency Diseases	Associate	26162572, 26193622, 38644452
Primary Myelofibrosis	Associate	32923146
Prostatic Hyperplasia	Associate	21532858
Prostatic Neoplasms	Associate	28903065
Prostatitis	Stimulate	39390078
Purpura Thrombocytopenic Idiopathic	Associate	26822028
Renal Insufficiency Chronic	Associate	38174742
Schizophrenia	Inhibit	30630651
Sjogren's Syndrome	Associate	29504848
Skin Diseases	Associate	32034084
Squamous Cell Carcinoma of Head and Neck	Associate	34091115
Status Asthmaticus	Associate	17951166
Tuberculosis Pulmonary	Associate	32291421
Uterine Cervical Neoplasms	Associate	23280621
Uterine Cervicitis	Associate	23280621
Virus Diseases	Associate	20208540

IL10RA (interleukin 10 receptor subunit alpha)