Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3587
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 10 receptor subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL10RA
Synonyms (NCBI Gene) Gene synonyms aliases
CD210, CD210a, CDW210A, HIL-10R, IL-10R1, IL10R
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammator
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137853579 G>A,C Pathogenic Coding sequence variant, non coding transcript variant, 5 prime UTR variant, missense variant
rs137853580 C>T Pathogenic Coding sequence variant, non coding transcript variant, intron variant, missense variant
rs138929400 T>G Conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
rs148808529 T>C Uncertain-significance, conflicting-interpretations-of-pathogenicity Non coding transcript variant, synonymous variant, coding sequence variant
rs149491038 C>T Pathogenic Non coding transcript variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT491524 hsa-miR-556-5p PAR-CLIP 23592263
MIRT491523 hsa-miR-548q PAR-CLIP 23592263
MIRT491522 hsa-miR-3160-3p PAR-CLIP 23592263
MIRT491521 hsa-miR-558 PAR-CLIP 23592263
MIRT491520 hsa-miR-4487 PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004920 Function Interleukin-10 receptor activity IBA
GO:0004920 Function Interleukin-10 receptor activity IDA 16982608, 24367025
GO:0004920 Function Interleukin-10 receptor activity IEA
GO:0004920 Function Interleukin-10 receptor activity TAS 8120391
GO:0005515 Function Protein binding IPI 11485736, 12093920, 12513909, 15837194, 16982608, 18395809, 20462497, 22087322, 24008843, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
146933 5964 ENSG00000110324
Protein
UniProt ID Q13651
Protein name Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)
Protein function Cell surface receptor for the cytokine IL10 that participates in IL10-mediated anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Upon binding to IL10, induces a conformational change in IL10RB, allowing IL
PDB 1J7V , 1LQS , 1Y6K , 1Y6M , 1Y6N , 5IXI , 6X93
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01108 Tissue_fac 4 111 Tissue factor Family
Tissue specificity TISSUE SPECIFICITY: Primarily expressed in hematopoetic cells including B-cells, T-cells, NK cells, monocytes and macrophages. Not expressed in non-hematopoetic cells such as fibroblasts or endothelial cells.
Sequence
MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVA
LLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNW
TVTNTRFSV
DEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTF
THKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTNVIIFF
AFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEA
FLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSC
SSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGS
ALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRC
LVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWS
FAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE
Sequence length 578
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
JAK-STAT signaling pathway
Toxoplasmosis
Tuberculosis
Human cytomegalovirus infection
  Interleukin-10 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Inflammatory Bowel Disease Inflammatory bowel disease 28 rs1192830343, rs1419560997, rs1591263883, rs137853579, rs137853580, rs149491038, rs368287711 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Anaplastic Lymphoma Anaplastic large cell lymphoma Through genome-wide clustered regularly interspaced short palindromic repeats (CRISPR) activation and knockout screens in ALCL cell lines, combined with RNA sequencing data derived from ALK inhibitor-relapsed patient tumors, we show that resistance to ALK 32573700 CBGDA
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abscess Associate 33849446
Acquired Immunodeficiency Syndrome Associate 20531015, 20976276
Adenocarcinoma Associate 23280621
Anal Gland Neoplasms Associate 30365510, 33849446
Arthritis Associate 22550014
Arthritis Rheumatoid Associate 16859503
Arthritis Rheumatoid Inhibit 36614150
Calculi Associate 39943638
Carcinoma Giant Cell Associate 21196886
Carcinoma Non Small Cell Lung Associate 10997808