Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3577
Gene name	C-X-C motif chemokine receptor 1
Gene symbol	CXCR1
Synonyms (NCBI Gene)	C-CC-C-CKR-1CD128CD181CDw128aCKR-1CMKAR1IL8R1IL8RAIL8RBA
Chromosome	2
Chromosome location	2q35
Summary	The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system.

Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017488	hsa-miR-335-5p	Microarray	18185580
MIRT029277	hsa-miR-26b-5p	Microarray	19088304
MIRT918149	hsa-miR-141	CLIP-seq
MIRT918150	hsa-miR-200a	CLIP-seq
MIRT918151	hsa-miR-2110	CLIP-seq
MIRT918152	hsa-miR-219-1-3p	CLIP-seq
MIRT918153	hsa-miR-3126-5p	CLIP-seq
MIRT918154	hsa-miR-3150a-3p	CLIP-seq
MIRT918155	hsa-miR-3175	CLIP-seq
MIRT918156	hsa-miR-3187-3p	CLIP-seq
MIRT918157	hsa-miR-3189-3p	CLIP-seq
MIRT918158	hsa-miR-3199	CLIP-seq
MIRT918159	hsa-miR-3670	CLIP-seq
MIRT918160	hsa-miR-3945	CLIP-seq
MIRT918161	hsa-miR-4253	CLIP-seq
MIRT918162	hsa-miR-4260	CLIP-seq
MIRT918163	hsa-miR-4299	CLIP-seq
MIRT918164	hsa-miR-4435	CLIP-seq
MIRT918165	hsa-miR-4515	CLIP-seq
MIRT918166	hsa-miR-4701-5p	CLIP-seq
MIRT918167	hsa-miR-4710	CLIP-seq
MIRT918168	hsa-miR-4728-5p	CLIP-seq
MIRT918169	hsa-miR-4792	CLIP-seq
MIRT918170	hsa-miR-4804-3p	CLIP-seq
MIRT918171	hsa-miR-502-5p	CLIP-seq
MIRT918172	hsa-miR-548s	CLIP-seq
MIRT918173	hsa-miR-588	CLIP-seq
MIRT918174	hsa-miR-759	CLIP-seq
MIRT918175	hsa-miR-939	CLIP-seq
MIRT1972136	hsa-miR-1266	CLIP-seq
MIRT1972137	hsa-miR-1291	CLIP-seq
MIRT1972138	hsa-miR-146b-3p	CLIP-seq
MIRT1972139	hsa-miR-3173-3p	CLIP-seq
MIRT1972140	hsa-miR-339-5p	CLIP-seq
MIRT1972141	hsa-miR-4421	CLIP-seq
MIRT1972142	hsa-miR-4518	CLIP-seq
MIRT1972143	hsa-miR-4668-5p	CLIP-seq
MIRT1972144	hsa-miR-4779	CLIP-seq
MIRT1972145	hsa-miR-515-5p	CLIP-seq
MIRT1972146	hsa-miR-570	CLIP-seq
MIRT2207953	hsa-miR-1224-5p	CLIP-seq
MIRT1972136	hsa-miR-1266	CLIP-seq
MIRT2207954	hsa-miR-1914	CLIP-seq
MIRT918152	hsa-miR-219-1-3p	CLIP-seq
MIRT2207955	hsa-miR-2467-3p	CLIP-seq
MIRT2207956	hsa-miR-3150b-3p	CLIP-seq
MIRT2207957	hsa-miR-3158-5p	CLIP-seq
MIRT2207958	hsa-miR-3678-3p	CLIP-seq
MIRT2207959	hsa-miR-3915	CLIP-seq
MIRT2207960	hsa-miR-4268	CLIP-seq
MIRT918164	hsa-miR-4435	CLIP-seq
MIRT2207961	hsa-miR-4448	CLIP-seq
MIRT1972142	hsa-miR-4518	CLIP-seq
MIRT2207962	hsa-miR-4677-3p	CLIP-seq
MIRT2207963	hsa-miR-4689	CLIP-seq
MIRT2207964	hsa-miR-4708-5p	CLIP-seq
MIRT2207965	hsa-miR-4784	CLIP-seq
MIRT918174	hsa-miR-759	CLIP-seq
MIRT2207966	hsa-miR-922	CLIP-seq
MIRT2207953	hsa-miR-1224-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SPI1	Activation	9867862

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002407	Process	Dendritic cell chemotaxis	IEA
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0004918	Function	Interleukin-8 receptor activity	IDA	10734056
GO:0004918	Function	Interleukin-8 receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8381837
GO:0004950	Function	Chemokine receptor activity	TAS	1840701
GO:0005515	Function	Protein binding	IPI	30384436, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006935	Process	Chemotaxis	IEA
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	10734056
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8381837
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016494	Function	C-X-C chemokine receptor activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0019959	Function	Interleukin-8 binding	IEA
GO:0019959	Function	Interleukin-8 binding	IPI	11564821
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0030667	Component	Secretory granule membrane	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031623	Process	Receptor internalization	IDA	10734056
GO:0031623	Process	Receptor internalization	IEA
GO:0038112	Process	Interleukin-8-mediated signaling pathway	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA

MIM	HGNC	e!Ensembl
146929	6026	ENSG00000163464

P25024

Protein name

C-X-C chemokine receptor type 1 (CXC-R1) (CXCR-1) (CDw128a) (High affinity interleukin-8 receptor A) (IL-8R A) (IL-8 receptor type 1) (CD antigen CD181)

Protein function

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor (PubMed:1840701). Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-cal

PDB

1ILP , 1ILQ , 2LNL , 6XMN , 8IC0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	56 → 305	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL

Sequence length

350

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Phospholipase D signaling pathway Endocytosis Epithelial cell signaling in Helicobacter pylori infection		Chemokine receptors bind chemokines G alpha (i) signalling events Neutrophil degranulation

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
-	no classification for the single variant	rs16858808, rs16858811	-
Cholangiocarcinoma	Benign; other	rs2234671	RCV003312796
CXCR1-related disorder	Benign; other; Likely benign	rs2234671, rs376194466, rs144295545, rs61752206, rs1269446865, rs142076386	RCV003973791 RCV003907219 RCV003933811 RCV003931822 RCV003914488 RCV003920487
Susceptibility to HIV infection	Uncertain significance	rs61755739, rs538588993, rs55808468	RCV003224665 RCV003224403 RCV001280985

Show/Hide Text Mining Associations (123)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abscess	Associate	12002274
Acquired Immunodeficiency Syndrome	Associate	17360650
Acute On Chronic Liver Failure	Inhibit	27974825
Adenocarcinoma Follicular	Associate	26617848
Adenocarcinoma Mucinous	Associate	27533245
Adenocarcinoma of Lung	Inhibit	35768814
Adenocarcinoma of Lung	Associate	37770496
Adenoma	Stimulate	26617848
Adenomyosis	Associate	16500343
Arthritis Rheumatoid	Associate	12932287, 24914212, 25853812
Asthma	Associate	17234659, 33602227, 36575422
Astrocytoma	Associate	9334359
Breast Diseases	Associate	28454081
Breast Neoplasms	Associate	23062209, 23149820, 28454081, 32702599, 33090404
Carcinogenesis	Associate	23924695
Carcinoma Endometrioid	Associate	27533245
Carcinoma Hepatocellular	Associate	23396733, 31684995
Carcinoma Non Small Cell Lung	Associate	21298036
Carcinoma Ovarian Epithelial	Associate	27533245
Carcinoma Squamous Cell	Associate	35769468
Cicatrix	Stimulate	29931443
Cicatrix	Associate	29931443
Colitis Collagenous	Stimulate	25948880
Colitis Lymphocytic	Associate	25948880
Colitis Ulcerative	Associate	12002274, 39328405
Colorectal Neoplasms	Associate	18959627, 21285972, 21791631, 22674296, 25541970, 30820706, 31137244, 35687912
COVID 19	Associate	32581077
Crohn Disease	Associate	12002274
Cushing's symphalangism	Associate	22152684
Cystic Disease Of Lung	Associate	22088968
Cystic Fibrosis	Associate	19046427, 22088968
Dental Caries	Associate	23470693
Diabetes Mellitus	Associate	29751399, 37773841
Diabetes Mellitus Type 2	Associate	32377527
Diabetic Nephropathies	Associate	36329882
Drug Hypersensitivity	Associate	25973893
Drug Related Side Effects and Adverse Reactions	Associate	34151690
Endometriosis	Associate	24133578
Epidermolysis Bullosa	Associate	28736230
Familial Primary Pulmonary Hypertension	Associate	33478117
Fibrosis	Associate	23396733
Gastroesophageal Reflux	Inhibit	15793866
Glioblastoma	Associate	30086759, 40362634
Glomerulonephritis Membranoproliferative	Associate	16541017
Glomerulonephritis Membranous	Stimulate	12055238
Gout	Associate	35116032
Hepatitis B	Associate	23396733
Hereditary Breast and Ovarian Cancer Syndrome	Associate	28454081
HIV Infections	Associate	21630248
Hypoxia Brain	Stimulate	24551277
Immunoglobulin G4 Related Disease	Associate	25973893
Infections	Associate	17360650
Inflammation	Associate	12002274, 15641067, 16179368, 18959627, 22051099, 25853812, 32581077, 34151690, 35920183, 37507547
Inflammatory Bowel Diseases	Associate	15214047, 24487271, 35022690
Keloid	Associate	29931443
Kidney Diseases	Associate	16541017
Kidney Failure Chronic	Inhibit	18235145
Leukemia	Associate	18842429, 29146966
Leukemia Large Granular Lymphocytic	Associate	12614207, 15902300, 18842429
Leukemia Myeloid Acute	Associate	8363581
Liver Diseases	Associate	21731723
Liver Failure	Associate	26482123
Lung Neoplasms	Associate	19309748, 22051099
Lupus Erythematosus Systemic	Associate	26395317, 39290707
Lupus Nephritis	Associate	16541017
Lymphatic Metastasis	Associate	25031742, 28454081, 31793192
Lymphatic Metastasis	Stimulate	25081383
Lymphoma	Associate	18842429
Lymphoma Follicular	Stimulate	35887224
Lymphoma Large B Cell Diffuse	Associate	35887224
Macrophage Activation Syndrome	Associate	21731723
Melanoma	Associate	19401689, 22441657
Moyamoya Disease	Associate	39290707
Muscular Dystrophy Duchenne	Associate	28736230
Neoplasm Metastasis	Associate	20459595, 23924695, 27780937
Neoplasms	Associate	14632759, 17686053, 19350238, 20459595, 21048114, 21085979, 21285972, 21791631, 23924695, 23995780, 25081383, 26267317, 26565620, 27151689, 27557518 View all (10 more)
Neoplasms	Stimulate	19401689
Neoplasms	Inhibit	21298036
Neutropenia	Associate	12614207
Obesity	Associate	26482123
Oculocutaneous albinism type 2	Associate	27780937
Osteoarthritis	Stimulate	26866940
Osteogenesis imperfecta type 3	Associate	27780937
Osteosarcoma	Associate	17360650
Ovarian Diseases	Associate	35920183
Ovarian Neoplasms	Associate	31793192, 33829065, 35920183
Pain	Associate	33530940
Pancreatic Neoplasms	Associate	25081383, 36012531, 36585453
Pancreatitis	Associate	25081383
Pemphigoid Benign Mucous Membrane	Associate	31486595
Periodic fever familial autosomal dominant	Associate	39328405
Pilomatrixoma	Associate	27151689
Plasma Cell Granuloma Pulmonary	Associate	26316141
Polyposis Syndrome Hereditary Mixed 1	Associate	19350238
Primary Myelofibrosis	Associate	15454487
Prodromal Symptoms	Associate	27780937
Prostatic Hyperplasia	Associate	26640404, 32542667
Prostatic Intraepithelial Neoplasia	Stimulate	15920165
Prostatic Neoplasms	Associate	15920165, 26640404
Pseudotumor Cerebri	Associate	29608535
Psoriasis	Associate	9424095
Pulmonary Arterial Hypertension	Associate	33816621
Pulmonary Disease Chronic Obstructive	Associate	35018096
Pyoderma Gangrenosum	Associate	24487271
Rectal Neoplasms	Stimulate	22674296
Rectal Neoplasms	Associate	25541970
Reperfusion Injury	Associate	33241954
Respiratory Distress Syndrome	Associate	27496101
Sarcoma Kaposi	Associate	15110993
Small Cell Lung Carcinoma	Associate	15545974, 16721367
Squamous Cell Carcinoma of Head and Neck	Associate	27557518
Status Asthmaticus	Associate	23904157
Stomach Neoplasms	Associate	14632759, 18025257, 23924695, 27780937, 34516330
Thyroid Cancer Papillary	Associate	25031742
Thyroid Neoplasms	Associate	31858554
Triple Negative Breast Neoplasms	Associate	30089134, 33090404
Tuberculosis	Associate	26316141
Tuberculosis Multidrug Resistant	Associate	33977111
Tuberculosis Pulmonary	Stimulate	26316141
Ulcer	Associate	12002274
Uterine Cervical Neoplasms	Associate	24551277
Vasculitis	Inhibit	22152684
Wounds and Injuries	Associate	31666007

CXCR1 (C-X-C motif chemokine receptor 1)