Gene Gene information from NCBI Gene database.
Entrez ID 3568
Gene name Interleukin 5 receptor subunit alpha
Gene symbol IL5RA
Synonyms (NCBI Gene)
CD125CDw125HSIL5R3IL5R
Chromosome 3
Chromosome location 3p26.2
Summary The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3),
miRNA miRNA information provided by mirtarbase database.
500
miRTarBase ID miRNA Experiments Reference
MIRT526668 hsa-miR-7110-3p HITS-CLIP 23824327
MIRT526667 hsa-miR-6817-3p HITS-CLIP 23824327
MIRT526665 hsa-miR-485-3p HITS-CLIP 23824327
MIRT526664 hsa-miR-539-3p HITS-CLIP 23824327
MIRT526663 hsa-miR-6873-3p HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
7
Transcription factor Regulation Reference
CREB1 Unknown 9742933
CREM Unknown 9742933
JUN Unknown 9742933
RFX1 Unknown 10330134;10706293
RFX2 Unknown 10330134;10706293
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0002437 Process Inflammatory response to antigenic stimulus IEA
GO:0004896 Function Cytokine receptor activity IBA
GO:0004896 Function Cytokine receptor activity IEA
GO:0004914 Function Interleukin-5 receptor activity IDA 22528658
GO:0004914 Function Interleukin-5 receptor activity TAS 1495999
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
147851 6017 ENSG00000091181
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q01344
Protein name Interleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5R-alpha) (IL-5RA) (CDw125) (CD antigen CD125)
Protein function Cell surface receptor that plays an important role in the survival, differentiation, and chemotaxis of eosinophils (PubMed:9378992). Acts by forming a heterodimeric receptor with CSF2RB subunit and subsequently binding to interleukin-5 (PubMed:1
PDB 1OBX , 1OBZ , 3QT2 , 3VA2 , 6H41 , 8TLD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09240 IL6Ra-bind 131 236 Interleukin-6 receptor alpha chain, binding Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on eosinophils and basophils.
Sequence
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAI
DQIN
PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSL
ICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF
Sequence length 420
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Hematopoietic cell lineage
Pathways in cancer
  Interleukin-3, Interleukin-5 and GM-CSF signaling
RAF/MAP kinase cascade
Interleukin receptor SHC signaling