IL5RA (interleukin 5 receptor subunit alpha)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3568
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 5 receptor subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL5RA
Synonyms (NCBI Gene) Gene synonyms aliases
CD125, CDw125, HSIL5R3, IL5R
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p26.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3),
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(500)
miRTarBase ID miRNA Experiments Reference
MIRT526668 hsa-miR-7110-3p HITS-CLIP 23824327
MIRT526667 hsa-miR-6817-3p HITS-CLIP 23824327
MIRT526665 hsa-miR-485-3p HITS-CLIP 23824327
MIRT526664 hsa-miR-539-3p HITS-CLIP 23824327
MIRT526663 hsa-miR-6873-3p HITS-CLIP 23824327
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(7)
Transcription factor Regulation Reference
CREB1 Unknown 9742933
CREM Unknown 9742933
JUN Unknown 9742933
RFX1 Unknown 10330134;10706293
RFX2 Unknown 10330134;10706293
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade TAS
GO:0002437 Process Inflammatory response to antigenic stimulus IEA
GO:0004896 Function Cytokine receptor activity IBA 21873635
GO:0004914 Function Interleukin-5 receptor activity TAS 1495999
GO:0005515 Function Protein binding IPI 1495999, 9516124, 12842047
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
147851 6017 ENSG00000091181
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Q01344
Protein name Interleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5R-alpha) (IL-5RA) (CDw125) (CD antigen CD125)
Protein function Cell surface receptor that plays an important role in the survival, differentiation, and chemotaxis of eosinophils (PubMed:9378992). Acts by forming a heterodimeric receptor with CSF2RB subunit and subsequently binding to interleukin-5 (PubMed:1
PDB 1OBX , 1OBZ , 3QT2 , 3VA2 , 6H41 , 8TLD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09240 IL6Ra-bind 131 → 236 Interleukin-6 receptor alpha chain, binding Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on eosinophils and basophils.
Sequence 
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQIN
PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSL
ICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF
Sequence length 420
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Hematopoietic cell lineage
Pathways in cancer 		  Interleukin-3, Interleukin-5 and GM-CSF signaling
RAF/MAP kinase cascade
Interleukin receptor SHC signaling