Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	353514
Gene name Gene Name - the full gene name approved by the HGNC.	Leukocyte immunoglobulin like receptor A5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LILRA5
Synonyms (NCBI Gene) Gene synonyms aliases	CD85, CD85F, ILT-11, ILT11, LILRB7, LIR-9, LIR9
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.42
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019221	hsa-miR-335-5p	Microarray	18185580
MIRT1109251	hsa-miR-1233	CLIP-seq
MIRT1109252	hsa-miR-2117	CLIP-seq
MIRT1109253	hsa-miR-3127-3p	CLIP-seq
MIRT1109254	hsa-miR-3667-3p	CLIP-seq
MIRT1109255	hsa-miR-4273	CLIP-seq
MIRT1109256	hsa-miR-4279	CLIP-seq
MIRT1109257	hsa-miR-4652-3p	CLIP-seq
MIRT2030347	hsa-miR-125a-3p	CLIP-seq
MIRT2030348	hsa-miR-3913-3p	CLIP-seq
MIRT2030349	hsa-miR-3934	CLIP-seq
MIRT2030350	hsa-miR-489	CLIP-seq
MIRT2030351	hsa-miR-640	CLIP-seq
MIRT2030352	hsa-miR-764	CLIP-seq
MIRT2561096	hsa-miR-217	CLIP-seq
MIRT2561097	hsa-miR-4252	CLIP-seq
MIRT2561098	hsa-miR-4299	CLIP-seq
MIRT2561099	hsa-miR-542-3p	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IMP	12393390
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	19009525
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0032396	Function	Inhibitory MHC class I receptor activity	IBA
GO:0032695	Process	Negative regulation of interleukin-12 production	IDA	19009525
GO:0032696	Process	Negative regulation of interleukin-13 production	IDA	19009525
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	12393390, 19009525
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	19009525
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	12393390, 19009525
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	12393390, 19009525
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	19009525
GO:0045087	Process	Innate immune response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12393390, 19009525
GO:0050867	Process	Positive regulation of cell activation	IDA	12393390
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	12393390
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	IMP	19009525

MIM	HGNC	e!Ensembl
606047	16309	ENSG00000187116

Protein

UniProt ID

A6NI73

Protein name

Leukocyte immunoglobulin-like receptor subfamily A member 5 (CD85 antigen-like family member F) (Immunoglobulin-like transcript 11) (ILT-11) (Leukocyte immunoglobulin-like receptor 9) (LIR-9) (CD antigen CD85f)

Protein function

May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

PDB

2D3V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	46 → 135	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed mostly in tissues of the hematopoietic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Among leukocytes, monocytes and neutrophils express the highest level. Expressed in CD14+ monocytes, but not

Sequence

MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRG
NSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYS
PAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHK
LSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAA
DNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLGILIFQDWHSQRSPQAAAGR

Sequence length

299

Interactions

View interactions

	KEGG		Reactome
	Osteoclast differentiation B cell receptor signaling pathway		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS
Takayasu Arteritis	Takayasu arteritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arthritis Rheumatoid	Stimulate	19009525
Cardiomyopathies	Inhibit	39267096
Cardiomyopathy Dilated	Inhibit	39267096
Cardiomyopathy Hypertrophic	Inhibit	39267096
Diabetes Mellitus	Inhibit	39267096
IgA Vasculitis	Stimulate	19009525
Inflammation	Associate	19009525
Labor Pain	Associate	20629487

LILRA5 (leukocyte immunoglobulin like receptor A5)