LILRA5 (leukocyte immunoglobulin like receptor A5)

Gene

• Entrez ID: 353514
• Gene name: Leukocyte immunoglobulin like receptor A5
• Gene symbol: LILRA5
• Synonyms (NCBI Gene): CD85, CD85F, ILT-11, ILT11, LILRB7, LIR-9, LIR9
• Chromosome: 19
• Chromosome location: 19q13.42
• Summary: The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019221	hsa-miR-335-5p	Microarray	18185580
MIRT1109251	hsa-miR-1233	CLIP-seq
MIRT1109252	hsa-miR-2117	CLIP-seq
MIRT1109253	hsa-miR-3127-3p	CLIP-seq
MIRT1109254	hsa-miR-3667-3p	CLIP-seq
MIRT1109255	hsa-miR-4273	CLIP-seq
MIRT1109256	hsa-miR-4279	CLIP-seq
MIRT1109257	hsa-miR-4652-3p	CLIP-seq
MIRT2030347	hsa-miR-125a-3p	CLIP-seq
MIRT2030348	hsa-miR-3913-3p	CLIP-seq
MIRT2030349	hsa-miR-3934	CLIP-seq
MIRT2030350	hsa-miR-489	CLIP-seq
MIRT2030351	hsa-miR-640	CLIP-seq
MIRT2030352	hsa-miR-764	CLIP-seq
MIRT2561096	hsa-miR-217	CLIP-seq
MIRT2561097	hsa-miR-4252	CLIP-seq
MIRT2561098	hsa-miR-4299	CLIP-seq
MIRT2561099	hsa-miR-542-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IMP	12393390
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	19009525
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0032396	Function	Inhibitory MHC class I receptor activity	IBA
GO:0032695	Process	Negative regulation of interleukin-12 production	IDA	19009525
GO:0032696	Process	Negative regulation of interleukin-13 production	IDA	19009525
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	12393390, 19009525
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	19009525
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	12393390, 19009525
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	12393390, 19009525
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	19009525
GO:0045087	Process	Innate immune response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12393390, 19009525
GO:0050867	Process	Positive regulation of cell activation	IDA	12393390
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	12393390
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	IMP	19009525

Other IDs

• MIM: 606047
• HGNC: 16309
• e!Ensembl: ENSG00000187116

Protein

• UniProt ID: A6NI73
• Protein name: Leukocyte immunoglobulin-like receptor subfamily A member 5 (CD85 antigen-like family member F) (Immunoglobulin-like transcript 11) (ILT-11) (Leukocyte immunoglobulin-like receptor 9) (LIR-9) (CD antigen CD85f)
• Protein function: May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.
• PDB: 2D3V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	46 → 135	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed mostly in tissues of the hematopoietic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Among leukocytes, monocytes and neutrophils express the highest level. Expressed in CD14+ monocytes, but not
• Sequence:

  MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRG
  NSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYS
  PAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHK
  LSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAA
  DNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLGILIFQDWHSQRSPQAAAGR

• Sequence length: 299

Pathways

KEGG:

Osteoclast differentiation
B cell receptor signaling pathway

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell