IGFBP1 (insulin like growth factor binding protein 1)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3484
Gene name Gene Name - the full gene name approved by the HGNC.
Insulin like growth factor binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IGFBP1
Synonyms (NCBI Gene) Gene synonyms aliases
AFBP, IBP1, IGF-BP25, PP12, hIGFBP-1
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma an
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(26)
miRTarBase ID miRNA Experiments Reference
MIRT006386 hsa-miR-29c-3p Luciferase reporter assay 21436257
MIRT006386 hsa-miR-29c-3p Luciferase reporter assay 21436257
MIRT006386 hsa-miR-29c-3p Luciferase reporter assay 21436257
MIRT022268 hsa-miR-124-3p Microarray 18668037
MIRT707558 hsa-miR-5580-3p HITS-CLIP 21572407
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
Transcription factor Regulation Reference
ATF4 Activation 16687408
ETS1 Unknown 21401636
EZH2 Unknown 21903722
FOXO1 Activation 15200677
FOXO1 Repression 15987820
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 24431302
GO:0005515 Function Protein binding IPI 16924115, 22578544, 26091039, 32814053
GO:0005520 Function Insulin-like growth factor binding TAS 2454104
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
146730 5469 ENSG00000146678
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P08833
Protein name Insulin-like growth factor-binding protein 1 (IBP-1) (IGF-binding protein 1) (IGFBP-1) (Placental protein 12) (PP12)
Protein function Multifunctional protein that plays a critical role in regulating the availability of IGFs such as IGF1 and IGF2 to their receptors and thereby regulates IGF-mediated cellular processes including cell migration, proliferation, differentiation or
PDB 1ZT3 , 1ZT5 , 2DSQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00219 IGFBP 30 → 84 Insulin-like growth factor binding protein Domain
PF00086 Thyroglobulin_1 176 → 251 Thyroglobulin type-1 repeat Domain
Sequence 
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCC
PMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGS
PESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIEL
YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP
GSPEIRGDPNCQIYFNVQN
Sequence length 259
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    ATF4 activates genes in response to endoplasmic reticulum stress
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Colonic neoplasms Malignant tumor of colon, Colonic Neoplasms rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 15059925
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 20864642 ClinVar
Myocardial Infarction Myocardial Infarction GWAS
Show/Hide Text Mining Associations (82)
Associations from Text Mining
Disease Name Relationship Type References
Abortion Spontaneous Associate 27174569
Adenocarcinoma Associate 31545451
Adenocarcinoma of Lung Associate 32533823, 36400857
Anemia Aplastic Associate 39596362
Arthritis Rheumatoid Inhibit 29131315
Asthma Associate 31133345
Atrophy Associate 8654638
Bipolar Disorder Associate 27063557
Breast Diseases Associate 31752829
Breast Neoplasms Associate 20110692, 28096479, 31083221, 32435229, 9325295