Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	347
Gene name	Apolipoprotein D
Gene symbol	APOD
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3q29
Summary	This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamil

Show/Hide all (10)

miRTarBase ID	miRNA	Experiments
MIRT790044	hsa-miR-214	CLIP-seq
MIRT790045	hsa-miR-3619-5p	CLIP-seq
MIRT790046	hsa-miR-3622b-5p	CLIP-seq
MIRT790047	hsa-miR-409-5p	CLIP-seq
MIRT790048	hsa-miR-4253	CLIP-seq
MIRT790049	hsa-miR-4436b-3p	CLIP-seq
MIRT790050	hsa-miR-4666-5p	CLIP-seq
MIRT790051	hsa-miR-4761-3p	CLIP-seq
MIRT790052	hsa-miR-545	CLIP-seq
MIRT790053	hsa-miR-761	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NOTCH3	Repression	21705670

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	IBA
GO:0000302	Process	Response to reactive oxygen species	IDA	18419796
GO:0000302	Process	Response to reactive oxygen species	IEA
GO:0001525	Process	Angiogenesis	NAS	21705670
GO:0005319	Function	Lipid transporter activity	NAS	3453108
GO:0005515	Function	Protein binding	IPI	7918467, 25416956, 25910212, 28514442, 31515488, 32296183, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 20551380
GO:0005615	Component	Extracellular space	IDA	21705670
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006006	Process	Glucose metabolic process	IDA	19176353
GO:0006629	Process	Lipid metabolic process	IBA
GO:0006629	Process	Lipid metabolic process	IDA	19176353
GO:0006869	Process	Lipid transport	IEA
GO:0006950	Process	Response to stress	IEA
GO:0007420	Process	Brain development	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	14551159
GO:0014012	Process	Peripheral nervous system axon regeneration	ISS
GO:0015485	Function	Cholesterol binding	IBA
GO:0015485	Function	Cholesterol binding	IDA	9278274
GO:0022626	Component	Cytosolic ribosome	ISS
GO:0030425	Component	Dendrite	ISS
GO:0042246	Process	Tissue regeneration	IEA
GO:0042246	Process	Tissue regeneration	ISS
GO:0042308	Process	Negative regulation of protein import into nucleus	IDA	14551159
GO:0043025	Component	Neuronal cell body	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	14551159
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	14551159
GO:0048678	Process	Response to axon injury	ISS
GO:0051895	Process	Negative regulation of focal adhesion assembly	IMP	21705670
GO:0060588	Process	Negative regulation of lipoprotein lipid oxidation	IDA	18419796
GO:0060588	Process	Negative regulation of lipoprotein lipid oxidation	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0071638	Process	Negative regulation of monocyte chemotactic protein-1 production	IDA	18842892
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	18842892
GO:2000098	Process	Negative regulation of smooth muscle cell-matrix adhesion	IMP	21705670
GO:2000405	Process	Negative regulation of T cell migration	IDA	18842892

MIM	HGNC	e!Ensembl
107740	612	ENSG00000189058

P05090

Protein name

Apolipoprotein D (Apo-D) (ApoD)

Protein function

APOD occurs in the macromolecular complex with lecithin-cholesterol acyltransferase. It is probably involved in the transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.

PDB

2HZQ , 2HZR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	43 → 184	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in liver, intestine, pancreas, kidney, placenta, adrenal, spleen, fetal brain tissue and tears.

Sequence

MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR
CIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWI
LATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVT
DQVNCPKLS

Sequence length

189

Interactions

View interactions

	Reactome
			Transport of fatty acids NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
APOD-related disorder	Likely benign; Benign	rs150664052, rs144811342, rs5952	RCV003921882 RCV003941998 RCV003895753

Show/Hide Text Mining Associations (60)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Stimulate	30467822, 9751198
Alzheimer Disease	Associate	37264161
Androgen Insensitivity Syndrome	Associate	19330472, 27583472
Bipolar Disorder	Stimulate	11274430
Brain Damage Chronic	Associate	25261976
Breast Neoplasms	Associate	11167212, 33550915, 34224831, 36243728, 7929425, 8311115, 8883401, 8943263
Carcinoma Hepatocellular	Associate	17589901
Carcinoma Squamous Cell	Associate	33671013
Carotid Stenosis	Associate	30335165
Cerebral Infarction	Associate	25261976
Colorectal Neoplasms	Associate	23296401
Coronary Artery Disease	Associate	33568140
Death	Associate	8311115
Dermatofibrosarcoma	Associate	14633610, 17885669
Diabetes Gestational	Associate	19944460
Diabetes Mellitus	Associate	19944460
Diabetic Nephropathies	Associate	32921312
Disorders of Sex Development	Associate	27583472
Dry Eye Syndromes	Associate	29234088
Endometrial Neoplasms	Associate	11167212
Esophageal Squamous Cell Carcinoma	Associate	12498717
Femur Head Necrosis	Associate	29750162
Fetal Growth Retardation	Associate	38069155
Fibroadenoma	Associate	26961242
Fibrocystic Breast Disease	Associate	8311115
Fibroma	Associate	17885669
Graves Ophthalmopathy	Associate	38536014
Heredodegenerative Disorders Nervous System	Associate	24167586
Histiocytoma Benign Fibrous	Associate	17885669
Hypoxia	Associate	37180146
Inflammation	Inhibit	37728985
Irritable Bowel Syndrome	Associate	37648784
Kidney Calculi	Stimulate	40253023
Liver Neoplasms	Associate	17589901
Lymphatic Metastasis	Stimulate	37310025
Lymphoma	Associate	32048780
Macular Degeneration	Associate	24167586
Mental Disorders	Associate	11274430
Neoplasms	Associate	17885669, 20585448, 23296401, 25513803, 8311115
Neurodegenerative Diseases	Associate	19936966, 24167586
Neurofibroma	Associate	17885669
Obesity	Associate	24558408
Osteoarthritis	Associate	34719950
Osteoarthritis	Inhibit	37728985
Osteoarthritis Knee	Associate	33903094
Osteoporosis	Inhibit	24167586
Ovarian Neoplasms	Associate	11167212
Parkinson Disease	Stimulate	31593110
Phyllodes Tumor	Associate	26961242
Pituitary Neoplasms	Associate	36750863
Psychotic Disorders	Associate	11274430
Schizophrenia	Associate	11274430
Solitary Fibrous Tumors	Associate	17885669
Stomach Neoplasms	Associate	29901187, 34129933, 34983559, 36578802, 38228846, 39527470
Stomach Neoplasms	Inhibit	37180146
Stroke	Associate	25261976
Thyroid Neoplasms	Associate	34221185
Urinary Bladder Neoplasms	Associate	25513803
Uterine Cervical Neoplasms	Associate	18217980, 33671013, 36536343, 39372720
Varicose Veins	Associate	39341975

APOD (apolipoprotein D)