Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3458
Gene name Gene Name - the full gene name approved by the HGNC.	Interferon gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IFNG
Synonyms (NCBI Gene) Gene synonyms aliases	IFG, IFI, IMD69
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IMD69
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q15
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor w

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2069707	G>A,C	Drug-response	Upstream transcript variant
rs34079299	TGTGTGTGTGTG>-,TG,TGTG,TGTGTG,TGTGTGTG,TGTGTGTGTG,TGTGTGTGTGTGTG,TGTGTGTGTGTGTGTG,TGTGTGTGTGTGTGTGTG,TGTGTGTGTGTGTGTGTGTG,TGTGTGTGTGTGTGTGTGTGTG,TGTGTGTGTGTGTGTGTGTGTGTG,TGTGTGTGTGTGTGTGTGTGTGTGTG	Risk-factor	Intron variant

Show/Hide all(34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006912	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR	22379033
MIRT006913	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR	22379033
MIRT006914	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR	22379033
MIRT006914	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR	22379033
MIRT006914	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR	22379033
MIRT007034	hsa-miR-29b-3p	Luciferase reporter assay	22772450
MIRT007285	hsa-miR-409-3p	Luciferase reporter assay	23360331
MIRT029122	hsa-miR-26b-5p	Microarray	19088304
MIRT437825	hsa-miR-125a-5p	ELISA, Microarray, qRT-PCR, Western blot, silico analysis	24759737
MIRT437970	hsa-miR-24-3p	qRT-PCR, Luciferase reporter assay, Western blot	24704866
MIRT437969	hsa-miR-181a-5p	qRT-PCR, Luciferase reporter assay, Western blot	24704866
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437970	hsa-miR-24-3p	qRT-PCR, Luciferase reporter assay, Western blot	24704866
MIRT437969	hsa-miR-181a-5p	qRT-PCR, Luciferase reporter assay, Western blot	24704866
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT007034	hsa-miR-29b-3p	Luciferase reporter assay	27812842
MIRT007034	hsa-miR-29b-3p	Luciferase reporter assay	27812842
MIRT1060884	hsa-miR-1305	CLIP-seq
MIRT1060885	hsa-miR-340	CLIP-seq
MIRT1060886	hsa-miR-3941	CLIP-seq
MIRT1060887	hsa-miR-4330	CLIP-seq
MIRT1060888	hsa-miR-466	CLIP-seq
MIRT1060889	hsa-miR-4672	CLIP-seq
MIRT1060890	hsa-miR-4731-3p	CLIP-seq
MIRT1060891	hsa-miR-4801	CLIP-seq
MIRT1060892	hsa-miR-607	CLIP-seq
MIRT2246419	hsa-miR-34c-3p	CLIP-seq
MIRT2389279	hsa-miR-664	CLIP-seq

Transcription factors

Show/Hide all(39)

Transcription factor	Regulation	Reference
ATF2	Activation	12836278;18641343;20006311;20304822
ATF3	Activation	20304822
CREB1	Activation	20006311;20685939
CREB1	Repression	11907114
CREB1	Unknown	7759501
EGR1	Unknown	8900159
EOMES	Unknown	20056084
EP300	Activation	12836278
GATA1	Unknown	12836278
GATA3	Unknown	21507199
IRF1	Activation	13678429
JUN	Activation	12626576;18641343;20006311;20304822
JUN	Unknown	12836278;7759501
MSC	Activation	19561533
MYCN	Unknown	9570357
NFATC1	Unknown	12836278
NFATC2	Unknown	12836278
NFIL3	Unknown	7565758
NFKB1	Activation	17407192;18690006
NFKB1	Unknown	21243522;9374532
PARP1	Unknown	17177976
PROX1	Repression	20064070
RELA	Activation	17407192;18690006
RELA	Unknown	21243522;9374532
RFX5	Unknown	12968017
STAT1	Activation	13678429
STAT1	Repression	15055356;18616672
STAT1	Unknown	16195385;20004484
STAT3	Repression	18616672
STAT4	Unknown	9558063;9642277
STAT5A	Activation	15528362
STAT5B	Unknown	15528362
TBX21	Activation	17541280;19348920;20977921;21540308
TBX21	Unknown	12938094;16498264;16737784;17705132;19879772;20056084;21507199;22521571;24752800
TFAP4	Unknown	12836278
USF1	Unknown	8900159
YY1	Activation	8756632
YY1	Repression	8756632
YY1	Unknown	12836278

Show/Hide all(90)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0001774	Process	Microglial cell activation	IGI	7715705, 19808651
GO:0001774	Process	Microglial cell activation	ISS
GO:0001819	Process	Positive regulation of cytokine production	IDA	30634164
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	22504299
GO:0002250	Process	Adaptive immune response	IBA	21873635
GO:0002281	Process	Macrophage activation involved in immune response	IDA	30634164
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005133	Function	Interferon-gamma receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	7617032, 11250200, 18252829, 28514442
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006915	Process	Apoptotic process	IGI	7828849
GO:0006959	Process	Humoral immune response	IBA	21873635
GO:0007050	Process	Cell cycle arrest	IDA	16942485
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10477596
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0009615	Process	Response to virus	IDA	16280321
GO:0010508	Process	Positive regulation of autophagy	IDA	23629966, 26347139
GO:0010628	Process	Positive regulation of gene expression	HDA	11487543
GO:0010628	Process	Positive regulation of gene expression	IDA	19423618, 20164187, 20209097, 22504299, 23817958
GO:0010628	Process	Positive regulation of gene expression	IGI	19808651
GO:0010628	Process	Positive regulation of gene expression	IMP	20889566
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IDA	23817958
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010634	Process	Positive regulation of epithelial cell migration	IDA	11698262
GO:0010835	Process	Regulation of protein ADP-ribosylation	IDA	22504299
GO:0030225	Process	Macrophage differentiation	IDA	30634164
GO:0030857	Process	Negative regulation of epithelial cell differentiation	ISS
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	22504299
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	18501882
GO:0032722	Process	Positive regulation of chemokine production	IDA	19423618
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	7605994, 8557999
GO:0032747	Process	Positive regulation of interleukin-23 production	IDA	20027291
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	30634164
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS	7715705
GO:0032834	Process	Positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved in immune response	IDA	20209097
GO:0033141	Process	Positive regulation of peptidyl-serine phosphorylation of STAT protein	IDA	16280321
GO:0033141	Process	Positive regulation of peptidyl-serine phosphorylation of STAT protein	NAS	21268089
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	IDA	16942485
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0040008	Process	Regulation of growth	IEA
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	22504299
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	15604419, 16280321
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	ISS
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	8383325
GO:0045589	Process	Regulation of regulatory T cell differentiation	TAS
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	16220542
GO:0045821	Process	Positive regulation of glycolytic process	ISS
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	23629966
GO:0048143	Process	Astrocyte activation	IDA	18375019
GO:0048143	Process	Astrocyte activation	ISS
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16942485
GO:0050729	Process	Positive regulation of inflammatory response	IDA	30634164
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0050769	Process	Positive regulation of neurogenesis	IGI	19808651
GO:0050796	Process	Regulation of insulin secretion	IDA	8383325
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	18373975
GO:0051173	Process	Positive regulation of nitrogen compound metabolic process	IGI	7715705
GO:0051607	Process	Defense response to virus	IEA
GO:0051712	Process	Positive regulation of killing of cells of other organism	IDA	7544003
GO:0051770	Process	Positive regulation of nitric-oxide synthase biosynthetic process	ISS
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	IDA	22504299, 23629966
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0060334	Process	Regulation of interferon-gamma-mediated signaling pathway	TAS
GO:0060550	Process	Positive regulation of fructose 1,6-bisphosphate 1-phosphatase activity	IDA	9282826
GO:0060552	Process	Positive regulation of fructose 1,6-bisphosphate metabolic process	IDA	9282826
GO:0060557	Process	Positive regulation of vitamin D biosynthetic process	IDA	9282826
GO:0060559	Process	Positive regulation of calcidiol 1-monooxygenase activity	IDA	9282826
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	22504299
GO:0090312	Process	Positive regulation of protein deacetylation	IDA	23629966
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	16942485
GO:0150076	Process	Neuroinflammatory response	ISS
GO:1900222	Process	Negative regulation of amyloid-beta clearance	ISS
GO:1901216	Process	Positive regulation of neuron death	IGI	7715705
GO:1901857	Process	Positive regulation of cellular respiration	ISS
GO:1902004	Process	Positive regulation of amyloid-beta formation	IGI	19808651
GO:1902004	Process	Positive regulation of amyloid-beta formation	ISS
GO:1902948	Process	Negative regulation of tau-protein kinase activity	IGI	19808651
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	HDA	11487543
GO:1903543	Process	Positive regulation of exosomal secretion	HDA	11487543
GO:1904440	Process	Positive regulation of iron ion import across plasma membrane	ISS
GO:1904783	Process	Positive regulation of NMDA glutamate receptor activity	ISS
GO:1904798	Process	Positive regulation of core promoter binding	IDA	23629966
GO:2000273	Process	Positive regulation of signaling receptor activity	ISS
GO:2000309	Process	Positive regulation of tumor necrosis factor (ligand) superfamily member 11 production	IDA	16220542

MIM	HGNC	e!Ensembl
147570	5438	ENSG00000111537

Protein

UniProt ID

P01579

Protein name

Interferon gamma (IFN-gamma) (Immune interferon)

Protein function

Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (PubMed:16914093, PubMe

PDB

1EKU , 1FG9 , 1FYH , 1HIG , 3BES , 6E3K , 6E3L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00714	IFN-gamma	15 → 153	Interferon gamma	Domain

Tissue specificity

TISSUE SPECIFICITY: Released primarily from activated T lymphocytes.

Sequence

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Sequence length

166

Interactions

View interactions

	KEGG		Reactome
	Proteasome Cytokine-cytokine receptor interaction HIF-1 signaling pathway Necroptosis TGF-beta signaling pathway Osteoclast differentiation Antigen processing and presentation JAK-STAT signaling pathway Natural killer cell mediated cytotoxicity IL-17 signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway Type I diabetes mellitus Leishmaniasis Chagas disease African trypanosomiasis Malaria Toxoplasmosis Amoebiasis Tuberculosis Hepatitis C Influenza A Herpes simplex virus 1 infection Pathways in cancer PD-L1 expression and PD-1 checkpoint pathway in cancer Inflammatory bowel disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Fluid shear stress and atherosclerosis		Interferon gamma signaling Regulation of IFNG signaling RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs) Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Show/Hide Causal Diseases (40)

Disease term	Disease name	dbSNP ID	References
Causal
Adrenoleukodystrophy	Adrenoleukodystrophy	rs128624213, rs128624214, rs1569541109, rs128624215, rs128624216, rs128624217, rs128624218, rs128624219, rs128624220, rs128624221, rs387906494, rs128624222, rs128624223, rs387906495, rs128624224 View all (125 more)	16319717
Anemia	Anemia, Aplastic anemia, idiopathic	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)	15327519
Anencephaly	Iniencephaly, Exencephaly	rs773607884	17075842
Aplastic anemia	Aplastic Anemia, Idiopathic aplastic anemia	rs113993991, rs113993993, rs864309668, rs121908974, rs199422265, rs199422270, rs104894176, rs104894180, rs28933973, rs104894182, rs28933376, rs771552960, rs786205093, rs193302876, rs113993992 View all (104 more)	15327519
Astrocytoma	Astrocytoma	rs555607708
Attention deficit hyperactivity disorder	Attention deficit hyperactivity disorder	rs786205019
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	16360218
Autoimmune diseases	Autoimmune Diseases	rs869025224	19077085, 9647229
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	19446661
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	19446661
Chordoma	Chordoma	rs80359391
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	10866311
Dermatitis	Dermatitis, Atopic, Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	18249437, 15347381, 11312644, 12484431
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent, Diabetes Mellitus, Ketosis-Prone, Diabetes Mellitus, Sudden-Onset	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	21340626
Ependymoma	Ependymoma	rs1555165565, rs1555993293
Epileptic encephalopathy	Encephalopathies	rs587776508, rs121918334, rs121918317, rs121918321, rs74315390, rs28939684, rs74315391, rs74315392, rs118192244, rs121918622, rs121918623, rs121917953, rs121917955, rs121918624, rs121918625 View all (860 more)	18282668
Glomerulonephritis	Glomerulonephritis	rs778043831	1825860
Hemimegalencephaly	Hemimegalencephaly	rs1057519914, rs1554438588
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912 View all (22 more)
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	7614408
Lymphoproliferative disorder	Lymphoproliferative Disorders	rs121908191, rs398122933, rs397514667, rs397514260, rs397514261, rs748418658, rs781593353	22617429
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	19446661
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	9794839
Mesothelioma	Mesothelioma	rs121907908, rs387906350, rs387906351	12768194
Multiple sclerosis	Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	23517930
Neural tube defect	Neural Tube Defects	rs121434297, rs137853061, rs137853062, rs768434408, rs777661576, rs747846362, rs200137991, rs780014899, rs574132670, rs786204013, rs147257424, rs763539350, rs776483190, rs781461462, rs1114167354 View all (26 more)	17075842
Neutropenia	Neutropenia	rs879253882
Optic nerve glioma	Optic Nerve Glioma	rs1279529138, rs1567848147
Pancytopenia	Pancytopenia	rs869312883, rs770551610, rs1131690788, rs530073586, rs374333820
Precocious puberty	Precocious Puberty	rs879255238, rs879255239, rs879255240, rs1264639964, rs1566764505
Renal carcinoma	Renal Cell Carcinoma	rs121913668, rs121913670, rs121913243, rs786202724
Renal cyst	Simple renal cyst	rs376586707, rs431905522, rs1057518761, rs1555454411, rs140039128, rs1567413573
Renal insufficiency	Renal Insufficiency	rs1596536873	8289579, 3091246
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	22450443
Sarcoma	Sarcoma, Epithelioid, Sarcoma, Spindle Cell, Sarcoma	rs11540652, rs104886003, rs137852790, rs1555927374	9794839
Schizophrenia	Schizophrenia, Acute schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	20132993, 23083632, 22623148
Tuberous sclerosis	Tuberous Sclerosis, TUBEROUS SCLEROSIS 2 (disorder)	rs118203447, rs118203597, rs118203426, rs118203396, rs137854083, rs45483392, rs45512692, rs137854337, rs45517179, rs28934872, rs45517214, rs121964862, rs45517148, rs45516293, rs137854218 View all (795 more)	16845661
West syndrome	West Syndrome	rs267606715, rs267608421, rs727503974, rs786205598, rs794727152, rs796053134, rs796053162, rs1057517854, rs267608618, rs1555952078, rs1555954752, rs749975104
Wolff-parkinson-white syndrome	Wolff-Parkinson-White Syndrome	rs111033205, rs121908987, rs3218716, rs199472712, rs869312065, rs1554284604, rs1553197939, rs1553624186, rs1553631968, rs1555100687, rs1555418832
Lymphoproliferative syndrome, x-linked	X-Linked Lymphoproliferative Disorder	rs111033623, rs111033628, rs111033624, rs1603238847, rs111033625, rs111033626, rs1603236465, rs111033629, rs111033630, rs1556404534, rs104894764, rs387907301, rs587777612, rs1556406033, rs1556404673 View all (17 more)	22617429

Show/Hide Unknown Diseases (16)

Disease term	Disease name	References	Source
Unknown
Appendicitis	Appendicitis, Ruptured Appendicitis	16367942	ClinVar
Atherosclerosis	Atherosclerosis	9169506	ClinVar
Celiac disease	Celiac Disease	30097691	ClinVar
Congestive heart failure	Congestive heart failure	3091246, 20938210	ClinVar
Crohn disease	Crohn Disease, Regional enteritis	21829567	ClinVar
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided	3091246, 20938210	ClinVar
Mental depression	Mental Depression, Unipolar Depression, Major Depressive Disorder	24993299, 23597432	ClinVar
Myocardial infarction	Myocardial Failure	20938210, 3091246	ClinVar
Specific learning disorder	Specific learning disability		ClinVar
Immunodeficiency	immunodeficiency 69		GenCC
Alopecia Areata	Alopecia Areata		GWAS
Ulcerative colitis	Ulcerative colitis		GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease		GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus		GWAS
Crohn Disease	Crohn Disease		GWAS
Eosinophilia	Eosinophilia		GWAS

Show/Hide Text Mining Associations (1195)

Disease Name	Relationship Type	References
Associations from Text Mining
3 Hydroxyacyl CoA Dehydrogenase Deficiency	Stimulate	17392368
3 Hydroxyacyl CoA Dehydrogenase Deficiency	Associate	18569454
3C syndrome	Associate	19753481
3C syndrome	Stimulate	34867990
Ablepharon macrostomia syndrome	Associate	26110930
Abortion Habitual	Associate	29017513
Abortion Habitual	Stimulate	9093132
Abortion Spontaneous	Stimulate	17482605, 33731680
Abortion Spontaneous	Associate	25963913, 33565696, 36096448
Acquired Immunodeficiency Syndrome	Inhibit	10602033, 8450057
Acquired Immunodeficiency Syndrome	Associate	11241270, 11593301, 2124960, 2572558, 32880631, 33176707, 33897692, 6439741, 8149667, 8815158, 9665966
Acquired Immunodeficiency Syndrome	Stimulate	26475133
Actinic cheilitis	Associate	25060152
Acute Coronary Syndrome	Associate	25591771, 25740578
Acute Coronary Syndrome	Stimulate	33705988
Acute Disease	Associate	23295883, 24696530
Acute Febrile Encephalopathy	Associate	22624006
Acute malaria	Associate	21818580
Acute On Chronic Liver Failure	Associate	21505270, 34774066
Acute Phase Reaction	Associate	29920351
Adenocarcinoma	Associate	19055699, 28526810, 7690428, 9119749
Adenocarcinoma	Inhibit	36445478
Adenocarcinoma	Stimulate	36790524
Adenocarcinoma of Lung	Associate	29555781, 30014971, 30840888, 30972766, 32686362, 33839701, 34337026, 35273829, 35836920, 36016939, 40682067, 7641214
Adenocarcinoma of Lung	Stimulate	31909418
Adenoma	Stimulate	17160410
Adenoma	Associate	23442743
Adenoma Islet Cell	Stimulate	37581620
Adenomatous Polyposis Coli	Associate	27374224
Adrenal Gland Neoplasms	Associate	17622250
Adrenocortical Adenoma	Associate	17622250
Adrenocortical Carcinoma	Associate	17622250, 35322867
AIDS Associated Nephropathy	Associate	25719800, 28543773
AIDS Associated Nephropathy	Inhibit	33828558
Alcoholism	Stimulate	26747782
Allan Herndon Dudley syndrome	Associate	37253337
Allergic Fungal Sinusitis	Associate	24204766, 26047816
Alopecia	Associate	37746940
Alopecia Areata	Associate	16374469, 30558329, 33807704, 7930677
Alopecia Areata	Stimulate	26551570
Alzheimer Disease	Associate	33206953, 35139885, 35283023, 40121165
Amaurosis Fugax	Associate	18307518
Amenorrhea	Stimulate	20065129
Amyotrophic Lateral Sclerosis	Inhibit	29246232
Amyotrophic Lateral Sclerosis	Associate	32246039, 37582053
Amyotrophic Lateral Sclerosis	Stimulate	36359827
Amyotrophic lateral sclerosis type 6	Associate	37582053
Androgen Insensitivity Syndrome	Stimulate	23904164
Anemia	Associate	23045477, 24336657, 28426727, 39962550
Anemia Aplastic	Associate	11843845, 12149196, 12750172, 14675414, 15327519, 15345281, 1586705, 16131564, 16434488, 17373677, 19109204, 21506940, 22797698, 26214243, 28459238, 34220798, 35274786, 36334505 View all (3 more)
Anemia Aplastic	Stimulate	12404285, 26764034
Anemia Sickle Cell	Stimulate	10641497, 12152923
Anemia Sickle Cell	Associate	17654682, 33776989
Anemia Sickle Cell	Inhibit	21953592
Aneurysm	Associate	30686933, 7962625
Angina Pectoris	Associate	16409458
Angina Stable	Associate	28260995, 29554212
Anodontia	Stimulate	39778225
Anthropophobia	Associate	29491459, 33936110
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	15762890
Antiphospholipid Syndrome	Associate	30687319, 30872365
Antisynthetase syndrome	Associate	30886734
Aortic Aneurysm	Associate	16297165
Aortic Aneurysm Abdominal	Associate	16297165, 20226696, 30686933, 32138469
Aortic Aneurysm Thoracic	Associate	30957625
Aortic Aneurysm Thoracic	Stimulate	38484620
Aortic Dissection	Stimulate	31427887
Aortic Valve Disease	Associate	30810667
Aortic Valve Insufficiency	Stimulate	34935306
Aortic Valve Stenosis	Associate	39986193
Aphasia Conduction	Inhibit	23667456
Arterial Occlusive Diseases	Associate	33776989
Arteriosclerosis	Associate	11934839
Arthritis	Associate	17179173, 17393419, 24315997, 25113810, 33168080
Arthritis	Stimulate	1914237, 31260948
Arthritis Infectious	Inhibit	36190378
Arthritis Juvenile	Associate	10765921, 17002793, 26747737, 27159026, 30089725, 32787920, 35860254
Arthritis Psoriatic	Associate	15482477, 16323244, 22277938, 25512250, 27496874, 27543964, 29980703, 7693825
Arthritis Psoriatic	Stimulate	16741508, 37893484
Arthritis Psoriatic	Inhibit	2476168, 9201310
Arthritis Reactive	Associate	15547094, 18062835, 8078923
Arthritis Rheumatoid	Associate	10343540, 10606983, 10692038, 10733472, 10931160, 11056676, 11219392, 11229457, 12115225, 12165096, 12562402, 12847679, 1347492, 14558082, 15140775 View all (58 more)
Arthritis Rheumatoid	Inhibit	11168012, 16572447, 23255246, 2827831
Arthritis Rheumatoid	Stimulate	12780697, 15022319, 16220542, 1914237, 32245307, 32868411, 32961930, 34301999, 38123480
Arthrogryposis	Associate	39198650
Arthropathy progressive pseudorheumatoid of childhood	Stimulate	19370184
Ascites	Associate	21203522, 28327095, 31440239, 31753017
Aspergillosis	Associate	32047500
Aspergillus meningitis	Associate	32047500
Asthma	Associate	10225979, 10452776, 11413353, 11703360, 12061423, 17127048, 17386028, 17532201, 18780949, 19217272, 20371397, 21179211, 21798578, 22192168, 23535363 View all (13 more)
Asthma	Stimulate	16449261, 17947510, 24450586
Asthma	Inhibit	21197090, 24107080, 24428972, 34331994
Asthma Occupational	Associate	23535363
Astrocytoma	Associate	10187764, 19740103
Astrocytoma	Inhibit	9065411
Ataxia Telangiectasia	Associate	17100756, 2172158, 31819434, 34737749, 35977003
Ataxia Telangiectasia	Stimulate	23529012, 26618646, 28056107
Atherosclerosis	Associate	11714861, 11805151, 11934839, 17485888, 18586252, 18793716, 19443843, 21346151, 21646352, 2492403, 25196434, 25478796, 26071079, 29062018, 30223437, 34082770, 35784287 View all (2 more)
Atherosclerosis	Stimulate	33874983
Atrophy	Stimulate	38004107
Atypical Hemolytic Uremic Syndrome	Associate	19509467
Autism Spectrum Disorder	Associate	18762240, 22226452, 31123562, 31616420, 37545517
Autism Spectrum Disorder	Stimulate	37108638
Autistic Disorder	Associate	23231720, 32875100
Autoimmune Diseases	Associate	16434488, 17928893, 18505427, 18782261, 22113482, 23243276, 23777204, 23891168, 25935003, 26171588, 27159026, 27312110, 27429419, 28444759, 28736298 View all (9 more)
Autoimmune Diseases	Stimulate	33705988
Autoimmune Diseases	Inhibit	34650558
Autoimmune Diseases of the Nervous System	Associate	24030736
Autoimmune Lymphoproliferative Syndrome	Stimulate	33059348
Bacteremia	Stimulate	36566774
Bacterial Infections	Stimulate	1714327, 23212542
Bacterial Infections	Inhibit	22749533
Bacterial Infections	Associate	23449998, 2502562, 34925324, 34956225, 39269158
Bantu siderosis	Stimulate	34083737
Barrett Esophagus	Stimulate	11889061
Behcet Syndrome	Associate	10513814, 10594567, 15196263, 15654836, 15654837, 18685727, 23336215, 25982097, 27222359, 29854829, 37003592
Behcet Syndrome	Stimulate	15248229, 15545055, 17056573, 20508866, 22385240, 25303043, 29534057, 39838177
Berylliosis	Associate	12449171, 34399367
beta Thalassemia	Associate	10519993, 32581238
Biliary Atresia	Associate	15128911, 29748604
Bipolar Disorder	Inhibit	29032575
Bipolar Disorder	Stimulate	37058046
Bipolar Disorder	Associate	38484669
Birdshot Chorioretinopathy	Associate	23295883
Blood Coagulation Disorders	Associate	26658659
Bone Diseases	Stimulate	15287939
Bone Diseases	Associate	23133532, 24611731, 29473714
Bone Diseases Metabolic	Associate	36077598
Bone Marrow Diseases	Associate	19497133
Bone Marrow Failure Disorders	Associate	12750172, 16131564, 17379072, 21659535, 7579440
Bone Neoplasms	Associate	37993664
Bone Resorption	Associate	25278075
Boutonneuse Fever	Associate	19386798
Brain Diseases	Associate	28543773, 29168181
Brain Diseases	Stimulate	9143252
Brain Diseases Metabolic Inborn	Associate	19095956
Brain Neoplasms	Associate	19497133, 30189044
Brain Neoplasms	Inhibit	33420630
Breast Neoplasms	Associate	10651943, 11936954, 14651776, 14993214, 15241475, 15365776, 15931634, 16116176, 17261184, 17697357, 19451644, 20418110, 20457620, 2109997, 21453513 View all (43 more)
Breast Neoplasms	Inhibit	22563434, 30657766
Bronchiectasis	Associate	36229050
Bronchiolitis	Stimulate	32628310, 36561744
Bronchiolitis	Inhibit	35228282
Bronchiolitis	Associate	9573240
Bronchiolitis Obliterans Syndrome	Stimulate	21270769
Bronchiolitis Obliterans Syndrome	Inhibit	21669298
Bronchiolitis Obliterans Syndrome	Associate	23607447, 29352737, 30303525, 33078555, 37742913
Bronchopulmonary Dysplasia	Associate	16754651
Brucellosis	Stimulate	20404074
Bruton type agammaglobulinemia	Associate	11433390, 22289994
Burkitt Lymphoma	Associate	28033393
Burkitt Lymphoma	Inhibit	32832566
Buruli Ulcer	Associate	28241036
Buschke Ollendorff syndrome	Stimulate	22132895
Calcinosis	Associate	28431214
Calcinosis	Stimulate	31034990
Calcinosis Cutis	Stimulate	16371631
Cancer Pain	Associate	33000216, 33037017
Carcinogenesis	Associate	25921106, 35341013
Carcinoma	Associate	27575372
Carcinoma Basal Cell	Associate	21980389, 28829805, 8450029
Carcinoma Basal Cell	Stimulate	22808251
Carcinoma Ductal	Associate	27903846
Carcinoma Embryonal	Associate	9420627
Carcinoma Giant Cell	Associate	8669478
Carcinoma Hepatocellular	Associate	14690454, 16785570, 17711513, 19126646, 21419713, 22056812, 22505239, 22634051, 23423978, 23940564, 26757951, 26893439, 27279136, 27321064, 27832318 View all (19 more)
Carcinoma Hepatocellular	Stimulate	25169554
Carcinoma Hepatocellular	Inhibit	29666149
Carcinoma Medullary	Stimulate	26965581
Carcinoma Merkel Cell	Associate	34968501
Carcinoma Non Small Cell Lung	Inhibit	21342183, 21507199, 25292102
Carcinoma Non Small Cell Lung	Associate	25609202, 28187172, 30278439, 31125352, 31627272, 31843013, 32493705, 34623465, 36089762, 37441079, 37979167, 8880099
Carcinoma Non Small Cell Lung	Stimulate	27244531
Carcinoma Ovarian Epithelial	Associate	21829534
Carcinoma Pancreatic Ductal	Associate	29343207, 32495519, 39176093, 39256468, 39684873
Carcinoma Renal Cell	Associate	10431690, 1356627, 15578685, 17622250, 19238009, 22493490, 23696916, 24777966, 26587829, 32469992, 32495158, 33177244, 33589528, 34789838, 34795663 View all (8 more)
Carcinoma Renal Cell	Inhibit	10491412, 35759229, 8004818
Carcinoma Renal Cell	Stimulate	10944605
Carcinoma Small Cell	Associate	33248321
Carcinoma Squamous Cell	Associate	10086856, 10383748, 10506169, 11710944, 19516264, 22402444, 28526810, 32265897, 40005446
Carcinoma Squamous Cell	Stimulate	27169370
Carcinoma Transitional Cell	Inhibit	16283306
Cardiofaciocutaneous syndrome	Associate	12404285
Cardiomyopathies	Stimulate	28026044, 33705988
Cardiomyopathy Dilated	Stimulate	21422001
Cardiomyopathy Dilated	Associate	28207945
Cardiomyopathy Hypertrophic	Associate	35328083
Cardiovascular Diseases	Associate	21646352, 23077565, 33172487, 35977003, 38152968
Cardiovascular Diseases	Stimulate	27992360, 36693381
Carotid Artery Diseases	Stimulate	27782101
Carotid Artery Thrombosis	Associate	30872365
Carotid Stenosis	Associate	25196434
Cartilage Diseases	Associate	19285161
Cartilage hair hypoplasia	Associate	7554401
Cataract	Associate	25303043
CD59 Deficiency	Stimulate	23058368
CD59 Deficiency	Associate	23592500, 36739295
Celiac Disease	Associate	12759242, 21288140, 23134879, 23844808, 25915602, 28934294, 30097691, 32612145, 35705047, 38040898
Celiac Disease	Stimulate	24971453
Cell Transformation Neoplastic	Associate	15695523, 38005222
Cell Transformation Neoplastic	Stimulate	34626802
Central Nervous System Diseases	Associate	39364412
Cerebral Infarction	Inhibit	23286717
Cerebral Infarction	Associate	35856366
Cerebrospinal Fluid Rhinorrhea	Stimulate	11985531
Cerebrovascular Disorders	Associate	25243172
Chagas Cardiomyopathy	Associate	30559742, 33660144, 34592495, 34867992, 37088297
Chagas Disease	Associate	16299288, 25144227, 30517089, 31669531
Chanarin Dorfman Syndrome	Stimulate	30912279
Chlamydia Infections	Stimulate	16232223
Chlamydia Infections	Associate	17030574
Chlamydial Pneumonia	Associate	17052347, 17493018
Cholangiocarcinoma	Associate	15794670, 18069763, 31976810, 32653521, 33737613
Cholangitis Sclerosing	Stimulate	28383652
Cholangitis Sclerosing	Associate	28597951, 37256725
Chordoma	Associate	27172898
Chorioamnionitis	Associate	25938217
Chorioamnionitis	Inhibit	39237269
Chromosome 3 Linked Frontotemporal Dementia	Associate	37543250
Chromosome Deletion	Inhibit	39891996
Chronic Disease	Associate	31072323
Chronic Periodontitis	Associate	20958339, 21198766, 24670840, 25530681, 28364573
Chronic Periodontitis	Stimulate	30304122, 30427403
Chronobiology Disorders	Associate	37028702
Cleft Lip	Associate	25139022, 25579819
Cleft Palate	Associate	22174866, 34646402
Cocaine Related Disorders	Stimulate	24650829
Cognition Disorders	Inhibit	29206475
Cognition Disorders	Associate	33324408
Cognitive Dysfunction	Associate	35283023
Colitis	Stimulate	25071069
Colitis	Associate	34147519, 37462681
Colitis Collagenous	Stimulate	31131860
Colitis Microscopic	Stimulate	16775121
Colitis Microscopic	Associate	27672296
Colitis Ulcerative	Stimulate	11167992, 18160345, 19318319, 20345984, 20547854, 25397893, 7664489, 9824577
Colitis Ulcerative	Associate	12974765, 17170025, 19309553, 20848535, 21818367, 25171510, 26698117, 26900298, 27152519, 28453768, 31191543, 8100205
Colitis Ulcerative	Inhibit	24450998
Coloboma	Associate	9933455
Colonic Diseases	Associate	21859832
Colonic Neoplasms	Associate	10389988, 10899312, 11761438, 1373349, 14500642, 15063730, 19074829, 19476491, 24121019, 33891607, 34389618, 36756126, 7728775, 8306368
Colonic Neoplasms	Inhibit	3124115, 9472684
Colorectal Neoplasms	Associate	11173732, 15188028, 16367922, 16630022, 20816019, 21859832, 22363134, 22781631, 24040001, 25076849, 25225903, 25358689, 25875151, 26837580, 26957265 View all (34 more)
Colorectal Neoplasms	Inhibit	17160410, 2141333, 38178618
Colorectal Neoplasms	Stimulate	38159250
Combined Saposin Deficiency	Associate	24373350
Common Variable Immunodeficiency	Associate	16634796, 20629103, 26684629, 32057767, 34146579, 34247288
Communicable Diseases	Associate	12782719, 18844578, 25171510, 26114934, 29599512
Communication Disorders	Stimulate	17052299, 23258791
Communication Disorders	Associate	32564053
Condylomata Acuminata	Associate	37053156
Congenital Abnormalities	Associate	34413849
Congenital disorder of glycosylation type 1L	Stimulate	29589181
Conjunctival Diseases	Associate	26618646
Conjunctivitis Allergic	Associate	25999672
Constriction Pathologic	Associate	32802883, 35345521
Conversion Disorder	Associate	21505270, 31992083, 33324408
Corneal Endothelial Cell Loss	Associate	2466402
Corneal Ulcer	Stimulate	23750216
Coronary Aneurysm	Associate	27124053
Coronary Artery Disease	Associate	19255340, 21307941, 21841301, 22780915, 27124053
Coronary Disease	Associate	16409458, 35345521
Coronary Disease	Stimulate	24167372
Coronavirus Infections	Stimulate	24725946
Corticosteroid Binding Globulin Deficiency	Associate	30335498
Corticosteroid Binding Globulin Deficiency	Stimulate	35578269
Cough	Inhibit	23768082, 34719421
COVID 19	Inhibit	32217834, 32217835, 34177923, 35711435, 36318037, 36946852, 37686360, 37756264
COVID 19	Associate	32463434, 32702299, 32706371, 32707842, 32866645, 32920092, 33041191, 33052054, 33078545, 33092653, 33138195, 33193384, 33492309, 33544720, 33664060 View all (58 more)
COVID 19	Stimulate	32501293, 33560482, 34157151, 36275702, 36362417, 37174682, 37674148
Craniocerebral Trauma	Stimulate	22342787
Critical Illness	Associate	33041191, 34346720
Crohn Disease	Stimulate	10719056, 18160345, 19318319, 19333939, 26072972, 30029674, 7664489
Crohn Disease	Associate	17444956, 17682002, 18497880, 18633626, 18825772, 1902808, 19273624, 20848535, 21155006, 22671596, 25171510, 26377844, 26937622, 27622767, 28586085 View all (8 more)
Crohn Disease	Inhibit	22167015, 24450998, 24943399
Cryoglobulinemia Familial Mixed	Stimulate	16142759
Cryopyrin Associated Periodic Syndromes	Associate	24773462
Cystic Fibrosis	Associate	10596703, 10844532, 12221127, 14525626, 15107292, 15463896, 16206514, 19399182, 20339685, 22729230, 25706389, 36480571
Cystic Fibrosis	Stimulate	15373916
Cystitis Interstitial	Associate	34876093
Cysts	Associate	29898177
Cytokine Release Syndrome	Associate	12351400, 29882021, 29953319, 34914824, 35015685, 35049413, 35705524, 38165854, 39328408, 39359733
Cytokine Release Syndrome	Stimulate	16636525, 25896248, 27076371, 29315094, 32963156, 34895310, 36797068, 39366520
Cytomegalovirus Infections	Associate	10702505, 12149221, 16725038, 17158960, 18173357, 19747638, 22182806, 22865914, 24594993, 27980216, 28338007, 29491459, 31522446, 31929537, 35490594
Cytomegalovirus Infections	Stimulate	12475762, 20633267, 25472703, 27829019, 30157919, 32828803
Cytomegalovirus Infections	Inhibit	40004169
Dacryocystitis	Associate	27358392
Dacryocystitis	Stimulate	35662094
Death	Inhibit	28346317
Death	Associate	32801995, 34867992, 36932108, 37270678, 37569646
Death	Stimulate	34445612
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	35154120
Deltaretrovirus Infections	Associate	17062725, 28384290
Dementia	Stimulate	27995575
Dementia Vascular	Associate	38452989
Demyelinating Diseases	Associate	10359806, 29518260
Dengue	Stimulate	26421267
Dengue	Associate	31521850, 31568656
Depressive Disorder	Inhibit	18276105
Depressive Disorder	Associate	32998701
Depressive Disorder	Stimulate	37058046
Depressive Disorder Major	Associate	37058046
Dermatitis	Stimulate	20795427, 8823363
Dermatitis Allergic Contact	Associate	10384911, 27383320
Dermatitis Allergic Contact	Stimulate	19785613, 20795427
Dermatitis Atopic	Associate	10620139, 10844552, 11989619, 1401997, 1714926, 1721013, 23600999, 24008422, 27304428, 29803800, 32035984, 34208434, 38131377, 38302650, 8082304, 8082305, 9409644, 9496691 View all (3 more)
Dermatitis Atopic	Inhibit	11703360, 18981165, 22427475, 26682905, 9030880, 9158100
Dermatitis Atopic	Stimulate	24518112, 33807704, 33975024, 35743310
Dermatitis Atopic 1	Associate	16166103, 17179689, 19639725
Dermatitis Contact	Associate	37187734
Dermatitis Exfoliative	Stimulate	8609251
Dermatomyositis	Inhibit	15829578
Dermatomyositis	Associate	19953283, 22235269, 34983619, 35436746, 36622131, 9212734
Dermatomyositis	Stimulate	28652434
Developmental Disabilities	Associate	32875100
Diabetes Gestational	Inhibit	36203592
Diabetes Mellitus	Inhibit	11309160, 32763913
Diabetes Mellitus	Associate	11681488, 16717396, 26268591, 31032897, 33727573, 34181338
Diabetes Mellitus	Stimulate	12153522, 25363329, 28454543, 32265833, 34283808, 34951048
Diabetes Mellitus Insulin Dependent 19	Associate	33727573
Diabetes Mellitus Type 1	Associate	11681488, 15140063, 23409157, 24973447, 25225671, 25516468, 27575603, 29229565, 29429978, 30082321, 31900242, 32346380, 32880687, 34650558
Diabetes Mellitus Type 1	Inhibit	16717396, 1675200, 27917625, 30723474, 36766809
Diabetes Mellitus Type 1	Stimulate	21289206, 21368230, 26981545, 28056107
Diabetes Mellitus Type 2	Associate	16717396, 22064865, 29752628, 31332162, 36209084, 37082729, 39202464
Diabetes Mellitus Type 2	Stimulate	26246197, 30451213, 34330510, 34763485
Diabetes Mellitus Type 2	Inhibit	30652669
Diabetic Foot	Associate	28736121
Diabetic Nephropathies	Associate	22180355
Diabetic Retinopathy	Stimulate	26268591, 29584759, 36465606
Diabetic Retinopathy	Inhibit	36766809
Diarrhea	Stimulate	16760259
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	21078084
Diffuse Cerebral Sclerosis of Schilder	Associate	19766516
Disease	Associate	10219772, 11171837, 11908704, 12524402, 16166103, 18821940, 19737237, 22774987, 26342013, 26444573, 27936497, 30021835, 31809599, 33806322, 37175481, 37890888 View all (1 more)
Disease	Stimulate	10337014, 11982596, 15247173, 17362267, 18435801, 24518112, 29903545, 7926902
Disease Progression	Associate	23806637
Distal myopathy Nonaka type	Associate	11159171
Down Syndrome	Associate	1825795, 31699819, 32572726, 33206953, 36401314
Drug Eruptions	Associate	12368207, 34157151
Drug Eruptions	Stimulate	8609251
Drug Hypersensitivity	Associate	10225979, 14722209, 17598032, 19657353, 30306557, 32431702, 7542574
Drug Hypersensitivity	Inhibit	15299030
Drug Hypersensitivity	Stimulate	18782262
Drug Hypersensitivity Syndrome	Stimulate	25651756
Drug Related Side Effects and Adverse Reactions	Associate	10089905, 10780664, 11839572, 15059848, 15446581, 16518599, 18395083, 22040089, 22160384, 23090124, 23122182, 25940887, 31554739, 32194559, 32269142 View all (8 more)
Drug Related Side Effects and Adverse Reactions	Stimulate	11067885, 11500375, 15154969, 15723658, 1709823, 25027966, 39927471, 7521890, 7798293, 7923248, 8104695, 8620520, 9753045
Drug Related Side Effects and Adverse Reactions	Inhibit	33123602
Dry Eye Syndromes	Associate	36187125, 37026295
Duane Retraction Syndrome	Associate	21203348
Ductus Arteriosus Patent	Associate	16754651
Duodenal Ulcer	Stimulate	9826379
Dysentery Bacillary	Associate	8675083
Dysentery Bacillary	Inhibit	9393836
Dyslipidemias	Inhibit	28316372
Dyspepsia	Stimulate	18946358
Dysplastic Nevus Syndrome	Associate	21659535
Dyspnea	Inhibit	23768082
Echinococcosis	Associate	10540165
Eclampsia	Stimulate	22958187
Ectodermal Dysplasia	Associate	35341013
Ectrodactyly cardiopathy dysmorphism	Associate	29396927
Eczema	Associate	19122650
Edema	Associate	35670482
Embolism Amniotic Fluid	Associate	25938217
Emphysema	Associate	33936110, 34675046
Encephalitis	Stimulate	19479051
Encephalitis	Associate	23639073, 31678190
Encephalitis Japanese	Associate	40536377
Encephalitis Tick Borne	Inhibit	31924650
Encephalocele	Associate	20222111
End Stage Liver Disease	Associate	21505270
Endocrine System Diseases	Stimulate	21623768
Endometrial Neoplasms	Associate	34424031, 35242299, 35262923, 39401154
Endometriosis	Associate	17531990, 37081668
Endometriosis	Inhibit	9176444, 9848307
Endophthalmitis	Stimulate	30296277
Enteritis	Associate	27672296
Enterocolitis	Inhibit	20011655
Enterocolitis Necrotizing	Inhibit	23472217
Enterocolitis Pseudomembranous	Stimulate	17393419
Enterovirus Infections	Associate	18782261, 19641142
Enterovirus Infections	Inhibit	30914258
Eosinophilic Esophagitis	Stimulate	21281807
Eosinophilic Esophagitis	Associate	33558373, 39884574
Epilepsies Partial	Associate	39259090
Epileptic Syndromes	Associate	20072626
Epstein Barr Virus Infections	Associate	10233902, 10393857, 16409297, 19015225, 25079909, 25361008, 28008151, 30837539, 35341013
Epstein Barr Virus Infections	Stimulate	32098275
Erdheim Chester Disease	Associate	17133532
Erythema	Associate	20795427
Erythema Multiforme	Associate	10571738, 20002170
Erythema Nodosum	Associate	10564558, 25398459
Erythema Nodosum	Inhibit	2523952
Erythema Nodosum	Stimulate	27556927
Erythrocytosis Familial 2	Associate	19062180
Esophageal Achalasia	Associate	39907396
Esophageal Neoplasms	Inhibit	25144454
Esophageal Neoplasms	Associate	32265897
Esophageal Squamous Cell Carcinoma	Associate	22013481, 28981100, 29855346, 34799871, 35463992, 36466860, 39307133
Essential Hypertension	Associate	29643275
Eye Infections Fungal	Associate	7860769
Fabry Disease	Associate	39234251
Fallopian Tube Diseases	Associate	12562392
Fallopian Tube Diseases	Inhibit	34414130
Familial Mediterranean Fever	Inhibit	37714974
Fanconi Anemia	Associate	12750172
Fanconi Anemia	Stimulate	12750172
Fatigue	Associate	22227623
Fatigue Syndrome Chronic	Associate	20447453, 22973830, 30929860, 35570777
Fatigue Syndrome Chronic	Stimulate	21619669, 9874656
Fatty Liver	Associate	31795627
Fetal Growth Retardation	Associate	25963913
Fever	Associate	10444185, 12439605, 22624006, 39223211
Fever	Stimulate	35918309
Fibrosarcoma	Associate	8464903
Fibrosis	Associate	12914676, 16718780, 23425350, 28339906, 28396119, 31853095, 32962821, 37471168
Fibrosis	Inhibit	22180355, 31006829
Fibrous Dysplasia Polyostotic	Associate	29850635
Fractures Bone	Associate	23133532
Frasier Syndrome	Associate	17290408
Gallbladder Neoplasms	Associate	37925508
Gastritis	Associate	12121897, 34755133, 7698689
Gastritis	Stimulate	27196487
Gastritis Atrophic	Associate	34104107, 35905420
Gastroenteritis	Associate	18062835
Gastrointestinal Neoplasms	Associate	19451644
Gastroschisis	Associate	31145102
GATA2 Deficiency	Inhibit	27409423, 37250921
Gaucher Disease	Inhibit	29317695
Genetic Diseases Inborn	Associate	30260027
Genital Neoplasms Female	Associate	1904315
Giant Cell Arteritis	Associate	22147555, 26698852, 29731755, 36533991, 37703805, 40095634, 8669478
Gingival Hyperplasia	Associate	17328839
Gingivitis	Associate	20958339
Glaucoma	Stimulate	22355254, 32043817
Glaucoma Angle Closure	Associate	25811482
Glaucoma Angle Closure	Stimulate	36254076
Glaucoma Open Angle	Stimulate	22355254
Glaucoma Open Angle	Associate	25811482
Glioblastoma	Associate	10349844, 1502171, 16947022, 18368485, 18594817, 1899864, 1974176, 20394835, 20493562, 22688424, 27409668, 2847168, 29532035, 32401608, 34566988 View all (8 more)
Glioblastoma	Inhibit	17960384, 21636707, 39513882
Glioma	Associate	1282676, 20495288, 24859836, 25415278, 27829230, 31152305, 36052280, 39364412, 7506810, 7521890
Glioma	Stimulate	8227070
Glomerulonephritis	Associate	27225718
Glomerulonephritis IGA	Associate	18650480, 28391282, 7908616
Glomerulonephritis Membranous	Associate	33754492, 35172688, 40018947
Glomerulosclerosis Focal Segmental	Associate	33059348
Glossitis Benign Migratory	Associate	21483819
Glossitis Benign Migratory	Stimulate	22246581
Glucosephosphate Dehydrogenase Deficiency	Associate	17533220, 25564106
Glut1 Deficiency Syndrome	Stimulate	23671580
Glycogen Storage Disease Type IV	Associate	27738386, 31941945
Graft vs Host Disease	Associate	10556195, 11520812, 16409297, 16809771, 20565368, 23089565, 25786571, 29142307, 30021835, 35015822, 7670118
Graft vs Host Disease	Stimulate	12239181, 14993881, 16131567, 20446793, 30142416, 35486633, 8609251
Granuloma	Associate	10211889, 10768979, 11918694, 12000723, 16753289, 21540308, 3083688, 32566036
Granuloma	Stimulate	16622230, 25141207, 32350353
Granulomatosis with Polyangiitis	Associate	10211889, 12000723, 15708894, 21412229
Granulomatous Disease Chronic	Associate	10828042, 11435314, 12000723, 2176110, 23773925, 24722620, 2821069, 2839835, 30260027, 31681257, 35113934, 35500221, 9376602
Granulomatous Disease Chronic	Inhibit	1312372, 28982143, 9129047
Graves Disease	Associate	12107104, 16478776, 16717396, 16970687, 30956992, 35720300, 7902787
Graves Ophthalmopathy	Associate	19117935, 24924312, 35896115
Growth mental deficiency syndrome of Myhre	Associate	33428109
Guillain Barre Syndrome	Associate	24174711, 39315093
HAIR AN syndrome	Stimulate	35217577
Hamartoma Syndrome Multiple	Associate	21361912
Hashimoto Disease	Associate	16820703, 16970687, 19250279, 26634912, 32662826, 34418900, 34869781, 36243929, 8809144
Hashimoto Disease	Inhibit	20696023
Hashimoto Disease	Stimulate	21623768, 23090124, 29877208, 32595646
Head and Neck Neoplasms	Associate	23363816, 26676749
Heart Diseases	Associate	12133984, 29473686, 30559742, 34867992
Heart Diseases	Stimulate	15681825, 27733811
Heart Failure	Associate	21418620, 36420258
Heart Valve Diseases	Stimulate	19040616
Heat Stroke	Associate	29933531
Helicobacter Infections	Stimulate	12738388, 16085918
Helicobacter Infections	Associate	15247172, 18946358, 36514982
Hematologic Diseases	Associate	12404285, 15286007, 37586321
Hematologic Neoplasms	Associate	15723658, 1902124, 34906138, 36669486, 38640253
Hemoglobinuria Paroxysmal	Associate	16131564, 17379072
Hemoptysis	Inhibit	23768082
Hemorrhagic Fever with Renal Syndrome	Associate	34871302
Hepatic Encephalopathy	Stimulate	26757951
Hepatitis Alcoholic	Associate	25501547, 31158952
Hepatitis Autoimmune	Associate	27183637, 28257599, 28597951, 29358858, 37102762
Hepatitis Autoimmune	Stimulate	28119269
Hepatitis Autoimmune	Inhibit	31191516
Hepatitis B	Associate	12970895, 1532590, 16718780, 19470388, 19625194, 21084489, 23395388, 24872585, 30602374, 33003293, 39736012, 9528902
Hepatitis B	Inhibit	22241125
Hepatitis B	Stimulate	32358389, 33506937
Hepatitis B Chronic	Associate	15996036, 23395388, 24520324, 32664850, 8706330
Hepatitis B Chronic	Stimulate	26416327
Hepatitis B Chronic	Inhibit	29666149
Hepatitis C	Associate	17916356
Hepatitis C	Stimulate	18336742
Hepatitis C	Inhibit	28780074
Hepatitis C Chronic	Associate	14690454, 16425360, 17634507, 21898483, 22792160
Hepatitis C Chronic	Stimulate	24130824
Hepatitis Chronic	Inhibit	28838891
Hepatitis D	Associate	38188634
Hepatitis Viral Human	Stimulate	17158635
Hepatomegaly	Associate	26684629
Hereditary Autoinflammatory Diseases	Associate	30383538, 36263058
Hereditary Breast and Ovarian Cancer Syndrome	Associate	34196131
Hereditary Myopathy with Early Respiratory Failure	Associate	26057401
Heredodegenerative Disorders Nervous System	Associate	25609305
Herpes Genitalis	Associate	12823283
Herpes Labialis	Inhibit	30756512
Herpes Simplex	Associate	23083630, 34552595
Herpes Zoster	Stimulate	12562395
Hidradenitis Suppurativa	Stimulate	27206704, 27819528, 36172698
Hidradenitis Suppurativa	Inhibit	31577850
Hidradenitis Suppurativa	Associate	32853177
Hirschsprung disease type d brachydactyly	Associate	18272909
Histiocytoma Malignant Fibrous	Associate	7691245
Histiocytosis Langerhans Cell	Associate	10590064, 16487180, 3137270
Histiocytosis with joint contractures and sensorineural deafness	Stimulate	33284430
HIV Infections	Inhibit	11122240, 17511038, 22955926, 24351015, 24959961, 27534685, 37376629, 38364104
HIV Infections	Associate	11399513, 11559831, 11699717, 15320908, 16272355, 16519915, 16725038, 18974880, 19395673, 19692459, 20653995, 20886040, 20926955, 2124960, 21303360 View all (42 more)
HIV Infections	Stimulate	11593301, 12931750, 1424271, 18573939, 18985732, 21556959, 24650829, 27995575, 29764370, 38538288, 8149667, 9566795
HIV Seropositivity	Associate	1351431
Hodgkin Disease	Associate	12100149, 16982932, 18203952, 24008079, 34584203
HTLV I Infections	Associate	11049991, 26546777, 7860769
HTLV I Infections	Stimulate	19079192
Huntington Disease	Associate	33679692, 39923663
Huntington Disease	Stimulate	37674148
Hydroa Vacciniforme	Stimulate	31064750
Hyper IgM Immunodeficiency Syndrome	Associate	12893749
Hyper IgM Immunodeficiency Syndrome Type 1	Inhibit	10207167
Hypercalcemia	Associate	11909970
Hyperglycemia	Associate	18586252, 27294162, 33934108, 35163309
Hyperlipidemias	Stimulate	34794403
Hyperplasia	Associate	35748061, 9824577
Hypersensitivity Delayed	Associate	10571738, 1458689, 2523952, 8823363
Hypersensitivity Delayed	Stimulate	9596698
Hypersensitivity Immediate	Associate	19639725, 27764137, 34571865, 39837900
Hypersensitivity Immediate	Stimulate	22287716
Hypertension	Associate	25973747
Hyperthyroidism	Associate	16970687
Hyperuricemia	Stimulate	35154100
Hypomagnesemia primary	Inhibit	39332767
Hypotension	Associate	16754651
Hypothyroidism	Associate	16820703
Hypoxia	Inhibit	12173346, 18227840, 20653473, 30459756, 33123602, 36445478
Hypoxia	Associate	23213275, 31935962, 34999917
Hypoxia	Stimulate	24933425
Ichthyosis	Associate	27554821
Ichthyosis Bullosa of Siemens	Associate	23268291
Idiopathic Pulmonary Fibrosis	Associate	10515397, 12914676, 26709222, 33859634, 7664490
Idiopathic Pulmonary Fibrosis	Inhibit	31511015
Idiopathic subglottic tracheal stenosis	Associate	32369195
IgA Deficiency	Inhibit	11966768
IgA Vasculitis	Inhibit	15286007
IgA Vasculitis	Associate	24659122, 3127092, 34895310, 9566801
Ige Responsiveness Atopic	Associate	27771325
IgG Deficiency	Inhibit	9409648
Immune Reconstitution Inflammatory Syndrome	Stimulate	20660788, 25589068, 26611774, 29538651
Immune Reconstitution Inflammatory Syndrome	Associate	23002445
Immune System Diseases	Associate	19451644, 21712187, 26549640, 34517836, 36669486
Immunoglobulin a deficiency 1	Associate	11966768
Immunologic Deficiency Syndromes	Associate	16792698, 23963039, 25329064, 26011559, 28159873, 31275997, 33013830, 33176707, 36069176
Immunologic Deficiency Syndromes	Stimulate	26618646
Immunologic Deficiency Syndromes	Inhibit	9042436
Infections	Inhibit	11049991, 12562394, 21655330, 26245365, 27367597, 28199704, 29137638, 31951326, 33224153, 34414130, 35113934, 35842407, 36016445, 36298850, 37686360 View all (5 more)
Infections	Associate	15373915, 17035315, 17100767, 18417583, 20084279, 21509779, 22624006, 22719887, 23563829, 25432406, 25528189, 26114934, 26287606, 26506932, 26609200 View all (17 more)
Infections	Stimulate	16232223, 17493018, 28235099, 28552470, 28966918, 34571855, 37201409, 39456722, 8132351, 9826379
Infectious Mononucleosis	Stimulate	10393857
Infertility	Associate	18828896, 26114934, 26586929, 34418900
Inflammation	Associate	10358077, 10438545, 10571738, 10931160, 11032886, 11114294, 11122256, 11132771, 11278357, 11468172, 11696237, 12421975, 12807916, 12871860, 12960156 View all (326 more)
Inflammation	Stimulate	11839572, 19822525, 20061762, 20665551, 21078084, 21771345, 22113482, 22277938, 22552879, 23276953, 24916404, 24920309, 24936783, 25027966, 25072865 View all (44 more)
Inflammation	Inhibit	12734381, 17063178, 17179689, 20653473, 21966414, 23255246, 29246232, 32180132, 33569050, 35218354, 35529864, 37871378, 38279321
Inflammatory Bowel Diseases	Associate	10403730, 11101567, 12171960, 1446859, 15486347, 16760259, 1740279, 19128033, 19450149, 20629103, 20848535, 25171510, 26377844, 27824650, 28400196 View all (9 more)
Inflammatory Bowel Diseases	Stimulate	11167992
Inflammatory Bowel Diseases	Inhibit	15020649, 32535589
Influenza Human	Stimulate	20483407, 22554464, 27543331
Influenza Human	Inhibit	21966414
Influenza Human	Associate	22024641, 23526940, 24696530, 24788814, 30192848, 32436879, 35494526, 36159843, 36912465, 9294140
Insulin Resistance	Associate	33934108, 34763485
Insulinoma	Stimulate	25480564
Intervertebral Disc Degeneration	Associate	32620160
Intervertebral Disc Degeneration	Inhibit	39252217
Intervertebral disc disease	Associate	20665551
Intestinal Diseases	Associate	15654837, 19520737, 30097691
Intestinal Perforation	Stimulate	36825028
Intracranial Aneurysm	Associate	26198819
Intracranial Hypertension	Associate	32265897, 35812382
Intussusception	Stimulate	34284276
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	23083630, 26011559, 28562756, 29589181, 30255293, 33296702, 33876776, 34517836, 36069176, 36094518, 36736301, 39586751
Invasive Pulmonary Aspergillosis	Associate	12393638, 21483748
Iron Deficiencies	Stimulate	11737064
Irritable Bowel Syndrome	Associate	17170025
Irritable Bowel Syndrome	Stimulate	22816602, 24667736, 26744473
Irritable Bowel Syndrome	Inhibit	23268291
Ischemia	Associate	9212734
Ischemic Stroke	Stimulate	30588195
Ischemic Stroke	Associate	34273195
Job Syndrome	Inhibit	12694256
Job Syndrome	Associate	28982143
Joint Diseases	Inhibit	16572447
Kaposi Varicelliform Eruption	Associate	23600999
Keratoacanthoma	Inhibit	40005446
Keratoconus	Associate	36051483
Keratosis Seborrheic	Stimulate	8450029
Kidney Diseases	Associate	12192641, 19050297, 24030736
Kidney Failure Chronic	Stimulate	15708894
Kidney Failure Chronic	Associate	15708894, 28651949, 29868028
Laryngeal Neoplasms	Associate	36215771
Laryngostenosis	Stimulate	28485188
Laryngotracheal Stenosis Progressive with Short Stature and Arthropathy	Associate	28485188, 28715559
Latent Infection	Associate	19747638
Latent Tuberculosis	Stimulate	23028695, 34512639
Latent Tuberculosis	Associate	23272100, 24176007, 25887222, 27852671, 28651949, 31687049, 34346720
Lead Poisoning Nervous System	Associate	22634051
Legionnaires' Disease	Associate	12511724
Leigh Disease	Associate	35103930, 35500221
Leiomyoma	Associate	36771423
Leishmaniasis Cutaneous	Associate	15716079, 33793565, 8443970
Leishmaniasis Diffuse Cutaneous	Inhibit	25397678
Leishmaniasis Visceral	Associate	35106507
Leprosy	Associate	10540222, 10564558, 15356162, 16339528, 20640364, 22683002, 23103228, 23449998, 23563829, 23936569, 27532668, 31600201, 33400985, 35462022
Leprosy	Stimulate	28426172
Leprosy Lepromatous	Inhibit	11698444, 30642265
Leprosy Lepromatous	Associate	22144494, 2450707, 34168371
Leprosy Multibacillary	Stimulate	28426172
Leprosy Multibacillary	Associate	9822276
Leprosy Tuberculoid	Associate	11698444, 23449998, 2450707, 7590888
Leprosy Tuberculoid	Stimulate	20008541, 28056107
Lesch Nyhan Syndrome	Stimulate	28056107
Leukemia	Inhibit	17115221, 28537657, 38640253
Leukemia	Associate	21067287, 21240485, 21274000, 21310823, 23241893, 24183305, 25003726, 27907031, 28522576, 3140910, 32696549, 35967339, 37919606, 8471780
Leukemia Acute X Linked	Associate	34299256
Leukemia B Cell	Stimulate	33421548
Leukemia Hairy Cell	Inhibit	3140910
Leukemia Large Granular Lymphocytic	Associate	10233902, 12480700, 17156396, 18086899, 24183305, 28736298, 29474442, 35411050
Leukemia Lymphocytic Chronic B Cell	Associate	10068672, 1532590, 15536147, 16413390, 1904285, 19245431, 19387007, 19757192, 23247726, 26376785, 27226587, 27590344, 2992637, 35371054, 9166857
Leukemia Lymphocytic Chronic B Cell	Inhibit	10403909, 16418292, 23136257, 24166938, 29276179, 33421548
Leukemia Lymphocytic Chronic B Cell	Stimulate	29315094
Leukemia Lymphoid	Associate	1511460
Leukemia Lymphoma Adult T Cell	Inhibit	23962110
Leukemia Lymphoma Adult T Cell	Associate	2421578, 29794791, 34906138, 35921533
Leukemia Monocytic Acute	Associate	27992360
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	11260079
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	15958635, 18613644, 1902397, 27793879, 28537657, 31695700, 33130330, 34785653, 35979386, 37919606
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	1714325, 1932740
Leukemia Myeloid	Associate	10766757, 11279136
Leukemia Myeloid Acute	Associate	11091213, 15657183, 16338495, 16612597, 17083564, 17115221, 1714325, 20814675, 22323453, 24903009, 25757160, 25795133, 25886742, 26081440, 26849076 View all (12 more)
Leukemia Myeloid Acute	Inhibit	24757092
Leukemia Prolymphocytic	Associate	1680497
Leukemia Prolymphocytic B Cell	Associate	3113513
Leukemia Prolymphocytic T Cell	Inhibit	10403909, 11703320, 1907531
Leukemia Prolymphocytic T Cell	Associate	1680497, 19995395, 24684541
Leukemia Promyelocytic Acute	Associate	3086842
Leukemia T Cell	Inhibit	27565576
Leukemia T Cell	Associate	9332328
Leukocyte adhesion deficiency type 1	Associate	17353346
Leukocyte adhesion deficiency type 1	Stimulate	32161179, 8270604
Leukocytosis	Inhibit	22734496
Leukoencephalopathy Progressive Multifocal	Inhibit	26061652
Leukomalacia Periventricular	Associate	15446581
Leukoplakia Oral	Associate	28053372
Lewy Body Disease	Associate	35283023
Leydig Cell Tumor	Stimulate	34009721
Lichen Planus	Associate	14962095, 28904313, 29526761, 31554739, 37317627, 7616001
Lichen Planus	Stimulate	31792433
Lichen Planus Oral	Associate	14962095, 24158143, 27544215, 34670484, 35064144, 37317627
Lichen Planus Oral	Stimulate	26594049, 29813046, 31792433
Lichen Sclerosus et Atrophicus	Associate	35103930
Light Fixation Seizure Syndrome	Associate	27607353
Liposarcoma Myxoid	Associate	31171504
Livedoid Vasculopathy	Associate	20813106
Liver Cirrhosis	Inhibit	11050046
Liver Cirrhosis	Associate	14607968, 15661146, 34181338
Liver Cirrhosis	Stimulate	31069827
Liver Cirrhosis Biliary	Associate	17158635, 19823170, 24375552, 33710617, 33815355, 8565296, 8706330
Liver Cirrhosis Biliary	Stimulate	37759496, 38228248
Liver Diseases	Stimulate	29969462
Liver Diseases	Associate	35485686
Liver Failure	Stimulate	11474123
Liver Failure	Associate	31846457, 36308662
Liver Failure Acute	Associate	12970895, 27284092, 36308662, 37926366
Liver Neoplasms	Stimulate	20433827
Lung Diseases	Associate	10596703, 16753289, 16754651, 17878156, 19835594, 30971743, 31072323, 31379071, 36480571, 40247373
Lung Diseases	Stimulate	24696530
Lung Diseases	Inhibit	28169347, 29206475
Lung Diseases Interstitial	Inhibit	19654941
Lung Diseases Interstitial	Stimulate	33298584
Lung Diseases Obstructive	Associate	22207354
Lung Injury	Associate	34483230
Lung Neoplasms	Associate	18801189, 20804502, 21342183, 26719671, 27467256, 30833945, 31501431, 31625289, 32067413, 34408924, 34685495, 35836920, 36089762, 36688994, 38203736, 9353425 View all (1 more)
Lung Neoplasms	Inhibit	24244422, 24894428, 26351076, 27447482
Lung Neoplasms	Stimulate	28187172, 30953795
Lupus Erythematosus Cutaneous	Associate	36212172
Lupus Erythematosus Discoid	Associate	23771123
Lupus Erythematosus Systemic	Associate	10023862, 11226290, 12568118, 12746905, 15001474, 16563187, 18811944, 19050297, 19399944, 19404947, 19675166, 20334681, 20936133, 21067287, 21437440 View all (27 more)
Lupus Erythematosus Systemic	Stimulate	11122256, 15542447, 18641361, 21370226, 24062776, 27814627, 29550813, 31040119, 31049024, 32868411, 33176801, 37204055, 39818255, 9010506
Lupus Erythematosus Systemic	Inhibit	24683191, 25225673, 27110576
Lupus Nephritis	Associate	12568118, 18163476, 18795942, 19021013, 27738386, 31171837, 32396533, 37099456, 37204055, 37213666
Lupus Nephritis	Stimulate	15373921
Lyme Disease	Associate	17177959, 17393419, 22246581, 30218476, 30550623, 35130450
Lymphadenitis	Associate	20883321
Lymphadenopathy	Associate	8467556
Lymphangiectasis Intestinal	Associate	9862365
Lymphangioleiomyomatosis	Associate	19893037
Lymphatic Diseases	Associate	23083630, 30104242
Lymphatic Metastasis	Associate	33160404
Lymphohistiocytosis Hemophagocytic	Associate	12930373, 32356861, 35510179, 35705524, 36401314
Lymphohistiocytosis Hemophagocytic	Stimulate	1954380, 31846457, 34461635
Lymphoma	Associate	15161670, 15817683, 1846327, 18781564, 19359411, 21418178, 23529012, 26183766, 3120822, 32649887, 35572591, 37329186, 38640253
Lymphoma	Inhibit	17823660
Lymphoma	Stimulate	35218354, 35432366
Lymphoma B Cell	Stimulate	18245523, 19797726
Lymphoma B Cell	Associate	24063735, 37586321
Lymphoma B Cell	Inhibit	27235588
Lymphoma B Cell Marginal Zone	Associate	32963045, 9767448
Lymphoma Extranodal NK T Cell	Inhibit	26497849
Lymphoma Follicular	Associate	25733581, 27357153
Lymphoma Large B Cell Diffuse	Associate	16809771, 23487038, 28537908, 31886296, 33664848, 33787861, 35561310, 9767448
Lymphoma Non Hodgkin	Associate	19066394, 19606255, 28246881
Lymphoma Non Hodgkin	Inhibit	21063024, 27797254
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	8941669
Lymphoma T Cell	Associate	26268241, 9329960, 9767448
Lymphoma T Cell Cutaneous	Associate	11154232, 11407974, 11841558, 15514008, 21942329, 22297640, 29794791, 34774537, 37691935
Lymphoma T Cell Cutaneous	Stimulate	18245523
Lymphoma T Cell Peripheral	Associate	30969023
Lymphoproliferative Disorders	Associate	10393857, 19656130, 22105417, 24266973
Lymphoproliferative Disorders	Inhibit	10393857, 1846327
Lymphoproliferative Syndrome X Linked 2	Associate	32514016
Macrophage Activation Syndrome	Associate	32375811, 37751296
Macrophage Activation Syndrome	Stimulate	35467709
Macular Degeneration	Stimulate	27266510, 29132135
Macular Degeneration	Associate	27733811
Malaria	Associate	32801995
Malaria Cerebral	Associate	20011600, 20348497, 32801995
Malaria Cerebral	Inhibit	37060041
Malformations of Cortical Development	Associate	23639073
Malnutrition	Inhibit	23429441
MASS syndrome	Inhibit	16753289
Mastitis	Stimulate	28182101, 37535921
Measles	Inhibit	15270865
Measles	Associate	27251754
Medulloblastoma	Stimulate	20433827
Medulloblastoma	Associate	21327638
Melanoma	Associate	10382738, 10540230, 10691911, 11079619, 11839572, 12060397, 12672071, 12713589, 1347555, 1386286, 15009724, 15160996, 15944290, 16835788, 1701809 View all (60 more)
Melanoma	Inhibit	15809206, 8242663
Melanoma	Stimulate	16224813, 28222797, 32231230, 8642353
Melanoma Cutaneous Malignant	Associate	32265897, 32495158, 32902917
Meningitis Bacterial	Stimulate	11985531
Meningitis Cryptococcal	Associate	23493728
Meningitis Viral	Stimulate	27914455
Meningoencephalitis	Stimulate	7890425
Mental Disorders	Associate	23083632, 23353117
Mesothelioma	Associate	36901697
Mesothelioma Malignant	Associate	21540305
Metabolic Diseases	Associate	22064865, 30862026
Metabolic Syndrome	Associate	29133519, 30862026, 32751810
Metabolic Syndrome	Stimulate	30383538
Metabolism Inborn Errors	Associate	36069176, 36736301
Microcephaly	Stimulate	37766239
Microsatellite Instability	Associate	31221124
Microsatellite Instability	Stimulate	35262923
Mitochondrial Diseases	Inhibit	23705001, 34867990
Mitochondrial Diseases	Associate	33660144
Mitochondrial Diseases	Stimulate	34867992, 35322867
Mitral Valve Insufficiency	Stimulate	24330612
Mixed Connective Tissue Disease	Associate	33336388
Mood Disorders	Inhibit	18276105
Mouth Diseases	Associate	10571738, 17096152, 25928531, 8669478
Mouth Neoplasms	Associate	11402621, 33952700
Movement Disorders	Associate	29168181
Mucocutaneous Lymph Node Syndrome	Stimulate	10233729, 30704426, 34035116
Mucocutaneous Lymph Node Syndrome	Inhibit	15270865
Mucocutaneous Lymph Node Syndrome	Associate	27124053, 3491174, 35222381, 36449533
Mucormycosis	Inhibit	36072605
Mucositis	Associate	25915602
Multi centric Castleman's Disease	Associate	18000163
Multicystic renal dysplasia bilateral	Associate	15673311
Multiple Myeloma	Inhibit	12393684, 23232072, 25526031, 29515123, 29632307, 30376895, 38640253
Multiple Myeloma	Associate	14717778, 15180863, 17201122, 17300840, 17363736, 20651070, 24489445, 27983725, 29089645, 30542346, 30872779, 31870332, 35563109, 36105747, 7949175, 8103718, 9207463, 9763578 View all (3 more)
Multiple Myeloma	Stimulate	15287939, 17935669, 32565533
Multiple Sclerosis	Stimulate	10193428, 10359806, 11422209, 16606644, 18261041, 25972006, 28336414, 9012830, 9771978
Multiple Sclerosis	Inhibit	11673527, 21212154, 29295981
Multiple Sclerosis	Associate	14558082, 16339578, 16754722, 17258784, 18769633, 19664140, 20065129, 21067287, 21622858, 25149293, 25690155, 27310932, 28218775, 29168181, 29518260 View all (10 more)
Multiple Sclerosis Chronic Progressive	Associate	30770703
Multiple Sclerosis Relapsing Remitting	Stimulate	22978757, 35328606
Multiple Sclerosis Relapsing Remitting	Associate	23637915
Multiple Trauma	Associate	22555808
Muscular Atrophy	Stimulate	38004107
Muscular Atrophy Spinal	Associate	11147573
Muscular Diseases	Associate	25339355
Muscular Dystrophy Duchenne	Associate	23133532
Myasthenia Gravis	Associate	10227809, 25889429, 26347149, 26826242, 39346912
Myasthenia Gravis	Inhibit	12865414
Myasthenia Gravis	Stimulate	25893403, 33813453
Mycobacterium avium intracellulare Infection	Associate	23083630, 32670274, 35090402, 35915436
Mycobacterium Infections	Associate	23083630, 28628454, 33296702
Mycobacterium Infections Nontuberculous	Associate	11139207, 22057826, 23036270, 23083630, 23243276, 25149293, 28628454, 30255293, 32817285, 34517836, 35833912, 36069176, 8960473
Mycobacterium Infections Nontuberculous	Inhibit	23144328
Mycoses	Associate	12847679, 22252124
Mycoses	Stimulate	25526183, 29673332
Mycosis Fungoides	Associate	18245523, 24938282, 29794791, 8027577
Mycosis Fungoides	Inhibit	32128597, 8941670
Myelodysplastic Syndromes	Associate	20472834, 21659535, 23236476, 24652987, 31406210
Myelodysplastic Syndromes	Inhibit	25608238
Myeloproliferative Syndrome Transient	Associate	11966768
Myocardial Infarction	Associate	26658659, 28260995
Myocarditis	Associate	19172849, 21422001, 38521068
Myocarditis	Stimulate	32269142
Myopathies Structural Congenital	Associate	27222359
Myositis	Associate	17405833, 25098831, 26057401, 30886734, 36739295
Myositis Inclusion Body	Associate	18420712, 21855683, 24594700, 30886734, 37731843
Myotonic Dystrophy	Associate	21414848, 33172487
Myotonic Dystrophy	Stimulate	27294162
Myotonic Dystrophy	Inhibit	38271857
Mysophobia	Associate	23326425
Mysophobia	Inhibit	25225461
Narcolepsy	Associate	25683265, 32669953
Nasal Polyps	Associate	19639723, 21538928, 24947894, 26239551, 31870738, 33210729
Nasopharyngeal Carcinoma	Inhibit	12536237
Nasopharyngeal Carcinoma	Associate	19497133, 19948041, 25361008, 26261644, 32564263
Nasopharyngeal Carcinoma	Stimulate	28207826
Necrosis	Associate	11278357
Necrosis	Stimulate	27575372
Neonatal herpes	Associate	12823283
Neoplasm Metastasis	Associate	11282551, 26381407, 33003293, 34159752, 36587234, 36741391
Neoplasm Metastasis	Stimulate	22952657, 32670264, 34021032
Neoplasm Metastasis	Inhibit	24375061, 35675399
Neoplasms	Associate	10192430, 10198604, 10403908, 10526158, 10540230, 10733503, 10820252, 10899312, 10944605, 11092984, 11282551, 11407974, 11859116, 12239181, 12244144 View all (387 more)
Neoplasms	Inhibit	10369458, 10601837, 10733505, 11278357, 11509647, 12173346, 15009724, 15161670, 15695523, 16189158, 17960384, 18163472, 19079205, 19596857, 20457620 View all (21 more)
Neoplasms	Stimulate	11173732, 11904731, 1386286, 15693140, 16371631, 17697357, 18179743, 1847844, 20816019, 24343228, 24569981, 25370533, 26805406, 27169370, 31171504 View all (7 more)
Neoplasms Adipose Tissue	Associate	31434495, 33934108
Neoplasms Basal Cell	Associate	8100398
Neoplasms Germ Cell and Embryonal	Associate	12942126
Neoplasms Squamous Cell	Associate	28378632, 33160404
Nephritis	Associate	24659122
Nephrosis congenital	Inhibit	28963877
Nephrosis Lipoid	Associate	21426892
Nephrotic Syndrome	Stimulate	20446793
Nerve Degeneration	Stimulate	21430507
Nervous System Diseases	Associate	11032886
Netherton Syndrome	Associate	29803800
Neural Tube Defects	Associate	16131564
Neuroblastoma	Associate	12107114, 12771917, 16886176, 16979248, 17032500, 17962944, 21626030, 21990352, 23719242, 2509084, 26452036, 30326856, 30629318, 31447858, 32514618 View all (9 more)
Neurocognitive Disorders	Associate	25719800, 28543773
Neurocognitive Disorders	Stimulate	27995575
Neurodegenerative Diseases	Associate	28543773, 33057020
Neurodevelopmental Disorders	Inhibit	29473714
Neuroectodermal Tumors	Associate	9201246
Neuroendocrine Tumors	Associate	15154969
Neurofibromatosis 1	Associate	27448806
Neuroinflammatory Diseases	Associate	33463108
Neurologic Manifestations	Associate	18457922, 35405431, 35868344
Neuromyelitis Optica	Associate	23637915, 26941100, 36248893
Neurosarcoidosis	Associate	35405431
Neuroschistosomiasis	Associate	14607968
Neutropenia	Stimulate	18279717
Neutropenia severe chronic	Associate	12828563, 15755293, 16982324
Neutrophilia Hereditary	Associate	26047816
Niemann Pick Disease Type C	Associate	19762521
Non alcoholic Fatty Liver Disease	Associate	31795627
Non Muscle Invasive Bladder Neoplasms	Associate	35027623, 37452272
Nonseminomatous germ cell tumor	Associate	37242266
Obesity	Associate	19564875, 28454543, 29133519, 29560551, 33934108, 35219585
Obesity	Stimulate	26246197, 33094626, 33809270, 34283808, 34330510, 35784287
Oculocutaneous albinism type 2	Associate	22287716
Olfaction Disorders	Associate	37270678, 37676246
Opportunistic Infections	Associate	22913682, 26011559
Optic Neuropathy Ischemic	Inhibit	21418620
Oral Ulcer	Associate	37653793, 8973622
Organizing Pneumonia	Associate	28686641
Osseous Heteroplasia Progressive	Associate	36803548
Osteoarthritis	Associate	14872492, 22380539, 24690414, 25807424, 28112376, 38157375
Osteoarthritis	Stimulate	33362761
Osteogenesis imperfecta type 1A	Associate	35711453
Osteogenesis imperfecta type 3	Associate	12351400
Osteomyelitis	Associate	23083630, 39849463
Osteopetrosis	Inhibit	28982143
Osteoporosis	Associate	22380539, 23133532, 25384921, 29745905, 35791093, 36077598, 39329776
Osteosarcoma	Associate	1473155, 2121483, 32388585
Osteosarcoma	Stimulate	37993664
Otitis Media	Associate	19728873
Otitis Media with Effusion	Associate	24434259
Ovarian Diseases	Associate	33231569
Ovarian Neoplasms	Associate	10376977, 11118442, 12438449, 1502188, 17349014, 19752753, 22083345, 28327095, 29242379, 30135206, 31064389, 33203236, 33921111, 34181334, 34626802 View all (10 more)
Ovarian Neoplasms	Stimulate	27458100
Overweight	Stimulate	34283808
Pain	Associate	22776106
Pain	Stimulate	23377438
Pancreatic Neoplasms	Associate	11454803, 19476837, 21321110, 22537161, 26423423, 27777771, 31548328, 32051287, 36494785, 8093857
Pancreatic Neoplasms	Inhibit	25274283
Pancreatitis Chronic	Stimulate	11310825
Pancreatitis Chronic	Associate	16127431, 30680957
Papilloma	Inhibit	22322668
Papillomavirus Infections	Associate	25141788, 35463689
Papillomavirus Infections	Stimulate	25885042
Paracoccidioidomycosis	Associate	31572394
Paraganglioma	Inhibit	35977513
Paraparesis Tropical Spastic	Associate	11468172, 17409595, 18509087, 19740339, 19997502, 21208912, 22335964, 24960164, 28376092, 31340370, 31402625
Paraparesis Tropical Spastic	Stimulate	31101076, 8785452
Parasitemia	Inhibit	22112357
Paratuberculosis	Associate	11101567
Parkinson Disease	Stimulate	10212304, 19480659
Parkinson Disease	Associate	18197754, 27230441, 33057020, 37686360, 38231411
Peanut Hypersensitivity	Associate	12671056
pediatric multisystem inflammatory disease COVID 19 related	Stimulate	34035116, 36263058
pediatric multisystem inflammatory disease COVID 19 related	Associate	34893640, 34914824
Pemphigoid Bullous	Associate	11710918, 29335495, 35140724
Pemphigus	Stimulate	18373702
Pemphigus	Associate	28815581
Penile Induration	Associate	18778497
Penile Neoplasms	Associate	37763742
Peptic Ulcer	Associate	12121897
Periapical Granuloma	Associate	25141207
Periapical Periodontitis	Associate	29898177
Periodic fever familial autosomal dominant	Associate	27575372, 31009059
Periodic fever familial autosomal dominant	Stimulate	33176801
Periodontal Diseases	Associate	22995210, 25832120, 30890897
Periodontitis	Associate	11953387, 16542362, 20958339, 23046796, 25832120, 27602578, 28736819, 30890897, 34381457
Periodontitis	Stimulate	34502071
Peripheral Arterial Disease	Associate	39221259
Periprosthetic Fractures	Associate	35306116
Peritonitis	Inhibit	34360900
Persian Gulf Syndrome	Associate	23800166
Persistent Infection	Stimulate	32408187
Persistent Infection	Inhibit	34350463
Persistent Infection	Associate	8467556
Pheochromocytoma	Inhibit	35977513
Pituitary Neoplasms	Associate	36631635
Plaque Amyloid	Stimulate	8478984
Plaque Atherosclerotic	Associate	18832677, 25196434, 34636650, 9691094
Plaque Atherosclerotic	Stimulate	8621803
Pleural Effusion	Associate	1371640, 19664147, 24134738, 27586092, 29504148, 31833092, 39809152
Pleural Effusion	Stimulate	25935866, 35819097, 39369468
Pleural Effusion Malignant	Associate	27447482, 27544053, 32867034
Pleurisy	Stimulate	8335379
Pneumonia	Associate	10573228, 22734496, 23174657, 24475220, 32564053, 36532054, 39837900
Pneumonia	Stimulate	21841301
Pneumonia Lipid	Inhibit	26194548
Pneumonia Mycoplasma	Inhibit	26191227
Pneumonia Mycoplasma	Associate	39837900
Pneumothorax	Inhibit	20653473
Polycystic Ovary Syndrome	Associate	30988342, 31115532, 32393090, 33094626
Polycythemia Vera	Associate	22965887, 24463275
Polyendocrinopathies Autoimmune	Associate	19037923
Polyendocrinopathies Autoimmune	Stimulate	36627721
Polymyositis	Associate	17405833, 19364061, 19953283
Polypoidal Choroidal Vasculopathy	Associate	26269006
Polypoidal Choroidal Vasculopathy	Stimulate	27266510
Polyposis Syndrome Hereditary Mixed 1	Associate	17160410
Polyps	Associate	20339685, 27468819, 29109117
Polysaccharide Storage of Unusual	Associate	22226452
Popliteal Artery Aneurysm	Inhibit	20488324
Post Acute COVID 19 Syndrome	Associate	37112866, 37569646, 39578766
Postpoliomyelitis Syndrome	Associate	22776106
Pouchitis	Stimulate	32811425, 9824577
Pre Eclampsia	Stimulate	17767018, 25461403
Pre Eclampsia	Associate	25065683, 25243172, 25461403, 25963913, 26010865, 26515425, 27999241, 30606080, 32713274
Precancerous Conditions	Associate	25458044
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	20943267
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	30443842
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11918534, 15606547, 19711075
Premature Birth	Associate	33565696
Primary Graft Dysfunction	Stimulate	18573422
Primary Immunodeficiency Diseases	Associate	15334201, 36672844
Primary Myelofibrosis	Associate	32331228
Propping Zerres syndrome	Associate	22913682, 28628454, 35090402, 35915436, 36672844, 36833193
Prostatic Hyperplasia	Associate	10705309, 12920242
Prostatic Neoplasms	Associate	10705309, 18211896, 25351720, 28317149, 29896191, 30488530, 33569050, 37067635, 37223924
Prostatic Neoplasms	Inhibit	25967142
Prostatic Neoplasms Castration Resistant	Associate	23126536
Prostatitis	Associate	10705309, 19820934, 33037017, 34646402, 7690428
Protein S Deficiency	Stimulate	34465315
Proteinuria	Associate	28963877
Psoriasis	Inhibit	14675183, 18981165
Psoriasis	Associate	18200047, 21085185, 22277938, 24008422, 28042206, 28239238, 29062018, 31509228, 35297512, 36288286, 36988247, 37314119, 7923918, 8027577, 8823363
Psoriasis	Stimulate	18245523, 21614010, 24518112, 35784287, 35848967
Pulmonary Atelectasis	Associate	33059348
Pulmonary Disease Chronic Obstructive	Associate	11390417, 17878156, 17996064, 20427767, 22183488, 22417244, 23731729, 24805101, 26403459, 26517304, 27769261, 32089881, 32160903, 34675046, 37307368
Pulmonary Disease Chronic Obstructive	Stimulate	19220836, 19229703, 20529083, 22352763, 28934595, 35553638
Pulmonary Disease Chronic Obstructive	Inhibit	19279357, 30349227, 33868270
Pulmonary Embolism	Associate	33529319, 35572511
Pulmonary Emphysema	Associate	12746043
Pulmonary Fibrosis	Associate	2540218, 30943978, 9949171
Purpura Thrombocytopenic Idiopathic	Associate	12176899, 14670926, 19077159, 19794139, 20100010, 20626741, 21385171, 21591983, 22111667, 23360331, 25707685, 26111958, 27050808, 28511637, 29333980 View all (5 more)
Purpura Thrombocytopenic Idiopathic	Stimulate	27554456, 31014934, 8639783
Purpura Thrombocytopenic Idiopathic	Inhibit	35796625
Purpura Thrombotic Thrombocytopenic	Associate	18339897
Pyelonephritis	Associate	20213923, 27352120
Pyelonephritis	Stimulate	30905425
Pyogenic arthritis pyoderma gangrenosum and acne	Associate	34492165
Q Fever	Associate	27876593, 40056764
Radiation Pneumonitis	Associate	33109238
Recombinant chromosome 8 syndrome	Associate	34465315
Rectal Neoplasms	Associate	30448924, 34389618
Recurrent respiratory papillomatosis	Associate	15138179
red meat allergy	Stimulate	33804792
Renal cell carcinoma 1	Inhibit	16585605
Renal Insufficiency	Associate	12149196, 1942774, 39962550
Renal Insufficiency Chronic	Associate	15458467, 24347824, 28396119
Renal Insufficiency Chronic	Stimulate	27992360
Reproductive Tract Infections	Associate	23555586
Respiratory Distress Syndrome	Associate	16754651, 34790197
Respiratory Distress Syndrome	Stimulate	34163488
Respiratory Distress Syndrome	Inhibit	37296478
Respiratory Sounds	Inhibit	12562394
Respiratory Sounds	Stimulate	32628310
Respiratory Syncytial Virus Infections	Inhibit	11980899
Respiratory Syncytial Virus Infections	Associate	12562394
Respiratory Tract Diseases	Associate	23181789, 23806637, 28230530, 30943978
Respiratory Tract Infections	Associate	27793801
Retinal Detachment	Stimulate	32542038, 33371882
Retinal Detachment	Associate	34544594
Retinal Detachment	Inhibit	34794403
Retinal Diseases	Associate	24626309
Retinal Neovascularization	Associate	23213275
Retinal Perforations	Stimulate	26618646, 33430811, 35409006
Retinal Vasculitis	Associate	3145163
Retinal Vein Occlusion	Associate	25978399, 31814701, 36180575
Retinitis	Associate	23592910, 3145163
Retinoblastoma	Associate	15133451
Retinoschisis	Associate	33601057
Rhabdomyosarcoma	Associate	21989738
Rheumatic Diseases	Associate	31861245
Rheumatic Fever	Associate	40226625
Rheumatic Heart Disease	Associate	15509528
Rheumatoid Nodule	Associate	12571841
Rhinitis	Associate	10211889, 26577568
Rhinitis Allergic	Inhibit	20074473
Rhinitis Allergic	Stimulate	33224143
Rhinitis Allergic	Associate	35064698, 35274773
Root Resorption	Stimulate	28782095
Rubella	Associate	29253144
Rufous oculocutaneous albinism	Inhibit	16189158
Salmonella Infections	Associate	21917897, 23083630, 23243276, 29523850
Sarcoidosis	Associate	10573228, 11817671, 18654018, 20659127, 21540308, 22984568, 24199653, 24768588, 27929051, 29449421, 31783271, 32701935, 32774332, 34399367, 7774049
Sarcoidosis	Stimulate	11091281, 12746045, 15303638, 24882950, 27460362, 9311498
Sarcoidosis	Inhibit	21177920, 23073617
Sarcoidosis Pulmonary	Associate	11390417, 21540308
Sarcoidosis Pulmonary	Stimulate	9311498
Sarcoma	Associate	33717062, 39778225
Sarcoma	Inhibit	36005179
Sarcoma Ewing	Inhibit	34440851
Sarcoma Ewing	Stimulate	37993664
Sarcoma Ewing	Associate	9201246
Sarcoma Synovial	Associate	31171504, 32269142
Schistosomiasis	Associate	14607968
Schizophrenia	Inhibit	20132993, 29032575, 35719348
Schizophrenia	Associate	23083632, 27169466, 32875100, 37301236
Schizophrenia	Stimulate	29803226
Sciatic Neuropathy	Associate	16142759
Scleroderma Diffuse	Inhibit	7826142
Scleroderma Localized	Associate	37028702, 37471168
Scleroderma Systemic	Associate	10366109, 11710721, 19536281, 26057401, 37310903, 7636301, 7826142
Segmentation syndrome 1	Associate	33428109
Seizures	Associate	23639073, 28843235
Seminoma	Associate	37242266
Sepsis	Inhibit	22187279, 34790197
Sepsis	Associate	24475220, 32996896, 34461635, 34566996, 35090402
Sepsis	Stimulate	33705988
Severe Acute Respiratory Syndrome	Associate	16672072, 17052299, 17537853, 19258635, 20015551, 23045477, 24518246, 28426727, 33393450
Severe Acute Respiratory Syndrome	Stimulate	21818580, 35908408
Severe Acute Respiratory Syndrome	Inhibit	32217835, 36949406
Severe Combined Immunodeficiency	Associate	7964459, 8704236
Severe Dengue	Stimulate	31521850
Severe Dengue	Associate	31568656
Severe Fever with Thrombocytopenia Syndrome	Associate	37903435
Sezary Syndrome	Associate	9649208
Shock Cardiogenic	Associate	35729851
Sialadenitis	Associate	27358392
Silicosis	Associate	36587204
Sjogren's Syndrome	Associate	11302869, 12384933, 1343766, 15692983, 16166103, 16507175, 17075845, 22018243, 23045702, 26183766, 31335688, 33179091, 34045583, 34594326, 35218354 View all (5 more)
Sjogren's Syndrome	Stimulate	12067313, 2444171, 25346207, 26904697, 31086200
Sjogren's Syndrome	Inhibit	27461134
Skin Diseases	Associate	21437440, 22673732, 22992805, 23771123, 24008422, 36672844, 37471168
Sleep Apnea Obstructive	Associate	31872261
Small Cell Lung Carcinoma	Associate	12107114, 1711927, 17143611, 2846175, 29020964, 3018738, 34228218, 36879122, 8880099
Smith Magenis Syndrome	Associate	26110930
Smoke Inhalation Injury	Inhibit	22805115
Smoldering Multiple Myeloma	Inhibit	26668134
Spinal Cord Diseases	Associate	11468172, 24960164
Spinal Cord Injuries	Associate	27618987, 33956875
Spirochaetales Infections	Inhibit	11121150
Spondylarthritis	Stimulate	18311795
Spondylarthropathies	Associate	10733472
Spondylarthropathies	Inhibit	11302872
Spondylitis	Associate	33208100
Spondylitis Ankylosing	Associate	11114280, 12759295, 18512784, 28843049
Spondylitis Ankylosing	Inhibit	20687202
Spondylitis Ankylosing	Stimulate	23607629
Squamous Cell Carcinoma of Head and Neck	Associate	17096152, 18547033, 19596857, 21207025, 25483651, 25591548, 30192802, 30320380, 30407504, 30722122, 30828910, 31422205, 31624067, 31970439, 32319563 View all (7 more)
Squamous Cell Carcinoma of Head and Neck	Inhibit	19480853, 21442435, 28053372
Status Asthmaticus	Inhibit	11985520, 21197090, 23226205
Status Asthmaticus	Associate	17127048, 17386028, 28373098, 30644695, 35111161, 36753209, 7807013
Status Asthmaticus	Stimulate	22387292
Stevens Johnson Syndrome	Associate	22992806
Still's Disease Adult Onset	Associate	11263769, 15361391, 35467709, 37751296
Still's Disease Adult Onset	Stimulate	34319596
Stomach Diseases	Associate	20646001, 34104107
Stomach Neoplasms	Associate	1331059, 14632759, 17717429, 20507321, 21070385, 22325465, 24175851, 25270738, 25432406, 26934444, 27147580, 29034543, 29259270, 29349089, 30223387 View all (11 more)
Stomach Neoplasms	Stimulate	20061762
Stomach Neoplasms	Inhibit	23243425
Stomach Ulcer	Stimulate	30043859
Stomatitis Aphthous	Stimulate	21805152
Streptococcal Infections	Associate	2147695
Stress Disorders Post Traumatic	Stimulate	30777365
Superinfection	Associate	31275997, 34790197
Sutton disease 2	Associate	10594567, 28922104
Sutton disease 2	Stimulate	28922104
Syndrome	Associate	10192453
Synovitis	Associate	30550623, 9358757
Systemic Inflammatory Response Syndrome	Associate	33208100
Takayasu Arteritis	Associate	15498051, 28874185
talaromycosis	Associate	31572394, 32880631, 36180657
Tang Hsi Ryu syndrome	Associate	20795427
Tang Hsi Ryu syndrome	Stimulate	33196557
Tertiary Lymphoid Structures	Associate	32963045
Testicular Germ Cell Tumor	Associate	35341013
Thromboangiitis Obliterans	Associate	12713785
Thrombocythemia Essential	Stimulate	24463275
Thrombocytopenia	Associate	28511637
Thrombocytopenia 1	Associate	25253772
Thrombocytosis	Associate	22965887
Thrombophilia	Stimulate	29981156
Thrombosis	Associate	29981156
Thymoma	Associate	10403908, 10886240, 31442209
Thyroid cancer medullary	Associate	18030468
Thyroid Cancer Papillary	Associate	21503841, 31159823, 32348468
Thyroid Diseases	Associate	16970687
Thyroiditis	Associate	20586818, 27555670, 29877208
Thyroiditis Autoimmune	Associate	1735190, 1899065, 19250279, 20586818, 32604892, 36032148, 36248893
Thyroiditis Autoimmune	Stimulate	34868029, 36362417
Thyroiditis Subacute	Associate	21751146
Tn Syndrome	Associate	32961930
Toxoplasmosis	Associate	23295883, 32126572
Toxoplasmosis Ocular	Associate	23100559, 24278490, 29426041, 39277179
Triple Negative Breast Neoplasms	Associate	21361912, 29933930, 32971948, 33495298, 34465315, 35377948, 37720228, 37981615, 40482645
Trypanosomiasis African	Associate	31824868
Tuberculosis	Associate	12472673, 12751024, 12869034, 14678204, 15373916, 15932510, 16313368, 16542361, 16556259, 16753289, 16859506, 17921069, 20725040, 20883321, 21303360 View all (29 more)
Tuberculosis	Inhibit	14977928, 15320888, 37909551, 9423855
Tuberculosis	Stimulate	15102771, 15908253, 31678658, 31821340
Tuberculosis Female Genital	Associate	26114934
Tuberculosis Meningeal	Inhibit	12562391, 23826366, 33828558, 37376629
Tuberculosis Meningeal	Associate	18199488, 20883321, 22961735, 25924204, 26681217, 27031950, 27861807, 33643286, 36823694
Tuberculosis Meningeal	Stimulate	21223348, 32265833, 32339714, 34176483, 35552657, 39809152
Tuberculosis Multidrug Resistant	Associate	27681197, 8912533
Tuberculosis Pleural	Stimulate	12472673, 24584041
Tuberculosis Pleural	Associate	17709420, 19664147, 24134738, 24708530
Tuberculosis Pulmonary	Associate	11500439, 14977928, 17159260, 18848499, 19703020, 22140472, 22771610, 23671613, 24176007, 24447912, 24473766, 25528189, 25887222, 26840977, 28333932 View all (10 more)
Tumor Virus Infections	Associate	33310773
Turner Syndrome	Inhibit	36758851
Tyrosine Kinase 2 Deficiency	Associate	36094518
Ulcer	Associate	16622230
Ulcer	Stimulate	18946358
Urinary Bladder Neoplasms	Associate	1353063, 15297736, 27999236, 29478100, 29752880, 36040901, 36567803, 39986350, 40777041, 8093683
Uropathy distal obstructive polydactyly	Stimulate	15673311
Uterine Cervical Diseases	Associate	19079205
Uterine Cervical Dysplasia	Stimulate	19079205, 25885042
Uterine Cervical Dysplasia	Inhibit	19089920, 23521696
Uterine Cervical Dysplasia	Associate	20084279, 39684873
Uterine Cervical Neoplasms	Associate	10521926, 11278357, 17615234, 18288269, 18337305, 23587428, 25141788, 25208560, 25921106, 27721577, 28378632, 28526810, 33017516, 33390854
Uterine Cervical Neoplasms	Stimulate	22094905
Uterine Cervicitis	Inhibit	19089920
Uterine Cervicitis	Associate	27738051, 35463689, 8098584
Uterine Diseases	Stimulate	21872231, 26586929
Uveal melanoma	Associate	17870068, 18296654, 22429778, 31025552, 33136179, 7488605
Uveitis	Associate	10469047, 15196263, 27478014, 32899567
Uveitis	Stimulate	32479651, 35061677
Uveitis Intermediate	Stimulate	14977779
Uveitis Intermediate	Associate	16024856
Uveitis Posterior	Associate	3145163
Uveomeningoencephalitic Syndrome	Stimulate	20591073
Uveomeningoencephalitic Syndrome	Associate	33384687
Varicella Zoster Virus Infection	Associate	23243276
Varicella Zoster Virus Infection	Inhibit	30918075
Vascular Diseases	Associate	2492403, 33196557, 34893640
Vascular Diseases	Stimulate	39578766
Vasculitis	Associate	23650522, 2492403
Vasculitis	Stimulate	34950150
Vesico Ureteral Reflux	Associate	24168677
Viremia	Associate	18788911, 29768624
Virus Diseases	Associate	12186889, 18292209, 21880131, 22182806, 2502562, 2542574, 25921106, 28076903, 29921861, 30459072, 30723748, 31422205, 33705988, 9551082, 9710601
Vitamin D Deficiency	Stimulate	27110576
Vitiligo	Stimulate	16224813
Vitiligo	Associate	23777204, 24681574, 25721262, 31097717, 32188902, 32705792, 33200798, 34081788, 35464413, 9077486
Vulvar Lichen Sclerosus	Associate	22113482, 37317627
Vulvar Neoplasms	Associate	9067409
Waldenstrom Macroglobulinemia	Associate	30104397
Weight Loss	Associate	34867990
West Nile Fever	Associate	33671821
Whipple Disease	Stimulate	34093562
Whooping Cough	Associate	22550536
Wilms Tumor	Inhibit	34519584
Wounds and Injuries	Stimulate	8100205
Xeroderma Pigmentosum	Stimulate	11710926
Yellow Fever	Associate	16278000
Yellow Fever	Stimulate	19906894
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Inhibit	12812920

IFNG (interferon gamma)