FCRL6 (Fc receptor like 6)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 343413
Gene name Fc receptor like 6
Gene symbol FCRL6
Synonyms (NCBI Gene)
FcRH6
Chromosome 1
Chromosome location 1q23.2
miRNA miRNA information provided by mirtarbase database.
9
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (9)
miRTarBase ID miRNA Experiments Reference
MIRT994193 hsa-miR-4528 CLIP-seq
MIRT994194 hsa-miR-4795-3p CLIP-seq
MIRT994195 hsa-miR-4803 CLIP-seq
MIRT994196 hsa-miR-802 CLIP-seq
MIRT2228960 hsa-miR-3136-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (14)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0005515 Function Protein binding IPI 20933011, 32296183
GO:0005886 Component Plasma membrane IDA 18991291, 20933011
GO:0005886 Component Plasma membrane IEA
GO:0006955 Process Immune response IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
613562 31910 ENSG00000181036
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6DN72
Protein name Fc receptor-like protein 6 (FcR-like protein 6) (FcRL6) (Fc receptor homolog 6) (FcRH6) (IFGP6)
Protein function Acts as a MHC class II receptor (PubMed:20519654). When stimulated on its own, does not play a role in cytokine production or the release of cytotoxic granules by NK cells and cytotoxic CD8(+) T cells (PubMed:17213291, PubMed:18991291). Does not
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 19 → 104 Immunoglobulin domain Domain
PF13895 Ig_2 111 → 200 Immunoglobulin domain Domain
PF13927 Ig_3 206 → 280 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed by cytolytic cells including NK cells, effector and effector-memory CD8(+) T-cells, and a subset of NKT cells (at protein level) (PubMed:17213291, PubMed:18991291, PubMed:20933011). Also expressed in gamma delta T cells and i
Sequence 
MLLWTAVLLFVPCVGKTVWLYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLH
FSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSP
EPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWC
EVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYS
FYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVL
FTPASNWLVPWLPASLLGLMVIAAALLVYVRSWRKAGPLPSQIPPTAPGGEQCPLYANVH
HQKGKDEGVVYSVVHRTSKRSEARSAEFTVGRKDSSIICAEVRCLQPSEVSSTEVNMRSR
TLQEPLSDCEEVLC
Sequence length 434
Interactions View interactions