FCRL6 (Fc receptor like 6)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
343413
Gene name Gene Name - the full gene name approved by the HGNC.
Fc receptor like 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FCRL6
Synonyms (NCBI Gene) Gene synonyms aliases
FcRH6
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT994193 hsa-miR-4528 CLIP-seq
MIRT994194 hsa-miR-4795-3p CLIP-seq
MIRT994195 hsa-miR-4803 CLIP-seq
MIRT994196 hsa-miR-802 CLIP-seq
MIRT2228960 hsa-miR-3136-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IBA 21873635
GO:0005515 Function Protein binding IPI 20933011, 32296183
GO:0005886 Component Plasma membrane IDA 18991291, 20933011
GO:0005887 Component Integral component of plasma membrane IBA 21873635
GO:0007166 Process Cell surface receptor signaling pathway IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613562 31910 ENSG00000181036
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q6DN72
Protein name Fc receptor-like protein 6 (FcR-like protein 6) (FcRL6) (Fc receptor homolog 6) (FcRH6) (IFGP6)
Protein function Acts as a MHC class II receptor (PubMed:20519654). When stimulated on its own, does not play a role in cytokine production or the release of cytotoxic granules by NK cells and cytotoxic CD8(+) T cells (PubMed:17213291, PubMed:18991291). Does not
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 19 → 104 Immunoglobulin domain Domain
PF13895 Ig_2 111 → 200 Immunoglobulin domain Domain
PF13927 Ig_3 206 → 280 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed by cytolytic cells including NK cells, effector and effector-memory CD8(+) T-cells, and a subset of NKT cells (at protein level) (PubMed:17213291, PubMed:18991291, PubMed:20933011). Also expressed in gamma delta T cells and i
Sequence 
MLLWTAVLLFVPCVGKTVWLYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLH
FSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSP
EPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWC
EVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYS
FYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVL
FTPASNWLVPWLPASLLGLMVIAAALLVYVRSWRKAGPLPSQIPPTAPGGEQCPLYANVH
HQKGKDEGVVYSVVHRTSKRSEARSAEFTVGRKDSSIICAEVRCLQPSEVSSTEVNMRSR
TLQEPLSDCEEVLC
Sequence length 434
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Esophagus neoplasm Malignant neoplasm of esophagus rs28934578, rs121918714, rs1567556006, rs1575166666 21642993
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Colorectal Cancer Colorectal Cancer In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1. GWAS, CBGDA
Show/Hide Text Mining Associations (4)
Associations from Text Mining
Disease Name Relationship Type References
HTLV I Infections Associate 17213291
Infections Stimulate 17213291
Leukemia Lymphocytic Chronic B Cell Stimulate 18991291
Neuralgia Associate 34741226