Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3434
Gene name Gene Name - the full gene name approved by the HGNC.	Interferon induced protein with tetratricopeptide repeats 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IFIT1
Synonyms (NCBI Gene) Gene synonyms aliases	C56, G10P1, IFI-56, IFI-56K, IFI56, IFIT-1, IFNAI1, ISG56, P56, RNM561
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q23.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein containing tetratricopeptide repeats that was originally identified as induced upon treatment with interferon. The encoded protein may inhibit viral replication and translational initiation. This gene is located in a cluster on

Show/Hide all(102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020013	hsa-miR-375	Microarray	20215506
MIRT021232	hsa-miR-146a-5p	Microarray	18057241
MIRT024022	hsa-miR-1-3p	Microarray	18668037
MIRT437408	hsa-miR-203a-3p	Next Generation Sequencing (NGS), qRT-PCR, Western blot	23785202
MIRT709996	hsa-miR-126-5p	HITS-CLIP	19536157
MIRT709995	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT709994	hsa-miR-1248	HITS-CLIP	19536157
MIRT709992	hsa-miR-4795-3p	HITS-CLIP	19536157
MIRT709993	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT445799	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445797	hsa-miR-6516-3p	PAR-CLIP	22100165
MIRT445796	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445795	hsa-miR-2054	PAR-CLIP	22100165
MIRT445794	hsa-miR-578	PAR-CLIP	22100165
MIRT445793	hsa-miR-335-3p	PAR-CLIP	22100165
MIRT445799	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445798	hsa-miR-1250-3p	PAR-CLIP	22100165
MIRT445797	hsa-miR-6516-3p	PAR-CLIP	22100165
MIRT445796	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445795	hsa-miR-2054	PAR-CLIP	22100165
MIRT445794	hsa-miR-578	PAR-CLIP	22100165
MIRT445793	hsa-miR-335-3p	PAR-CLIP	22100165
MIRT737067	hsa-miR-4756-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33707417
MIRT709996	hsa-miR-126-5p	HITS-CLIP	19536157
MIRT709995	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT709994	hsa-miR-1248	HITS-CLIP	19536157
MIRT709992	hsa-miR-4795-3p	HITS-CLIP	19536157
MIRT709993	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT445799	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445797	hsa-miR-6516-3p	PAR-CLIP	22100165
MIRT445796	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445795	hsa-miR-2054	PAR-CLIP	22100165
MIRT445794	hsa-miR-578	PAR-CLIP	22100165
MIRT445793	hsa-miR-335-3p	PAR-CLIP	22100165
MIRT445799	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445798	hsa-miR-1250-3p	PAR-CLIP	22100165
MIRT445797	hsa-miR-6516-3p	PAR-CLIP	22100165
MIRT445796	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445795	hsa-miR-2054	PAR-CLIP	22100165
MIRT445794	hsa-miR-578	PAR-CLIP	22100165
MIRT445793	hsa-miR-335-3p	PAR-CLIP	22100165
MIRT2246315	hsa-miR-329	CLIP-seq
MIRT2246316	hsa-miR-362-3p	CLIP-seq
MIRT2246317	hsa-miR-3941	CLIP-seq
MIRT2246318	hsa-miR-4272	CLIP-seq
MIRT2246319	hsa-miR-4666-5p	CLIP-seq
MIRT2246320	hsa-miR-600	CLIP-seq
MIRT2246321	hsa-miR-603	CLIP-seq
MIRT2549561	hsa-miR-3129-3p	CLIP-seq
MIRT2549562	hsa-miR-3143	CLIP-seq
MIRT2246315	hsa-miR-329	CLIP-seq
MIRT2246316	hsa-miR-362-3p	CLIP-seq
MIRT2549563	hsa-miR-374a	CLIP-seq
MIRT2549564	hsa-miR-374b	CLIP-seq
MIRT2549565	hsa-miR-376c	CLIP-seq
MIRT2246317	hsa-miR-3941	CLIP-seq
MIRT2549566	hsa-miR-409-3p	CLIP-seq
MIRT2246318	hsa-miR-4272	CLIP-seq
MIRT2549567	hsa-miR-4652-3p	CLIP-seq
MIRT2246319	hsa-miR-4666-5p	CLIP-seq
MIRT2549568	hsa-miR-4684-5p	CLIP-seq
MIRT2549569	hsa-miR-4753-3p	CLIP-seq
MIRT2549570	hsa-miR-4762-3p	CLIP-seq
MIRT2549571	hsa-miR-4766-5p	CLIP-seq
MIRT2549572	hsa-miR-4768-5p	CLIP-seq
MIRT2549573	hsa-miR-4778-5p	CLIP-seq
MIRT2549574	hsa-miR-485-3p	CLIP-seq
MIRT2549575	hsa-miR-499-3p	CLIP-seq
MIRT2549576	hsa-miR-499a-3p	CLIP-seq
MIRT2549577	hsa-miR-543	CLIP-seq
MIRT2549578	hsa-miR-570	CLIP-seq
MIRT2549579	hsa-miR-582-5p	CLIP-seq
MIRT2246320	hsa-miR-600	CLIP-seq
MIRT2246321	hsa-miR-603	CLIP-seq
MIRT2549580	hsa-miR-653	CLIP-seq
MIRT2549561	hsa-miR-3129-3p	CLIP-seq
MIRT2549562	hsa-miR-3143	CLIP-seq
MIRT2246315	hsa-miR-329	CLIP-seq
MIRT2246316	hsa-miR-362-3p	CLIP-seq
MIRT2549563	hsa-miR-374a	CLIP-seq
MIRT2549564	hsa-miR-374b	CLIP-seq
MIRT2549565	hsa-miR-376c	CLIP-seq
MIRT2246317	hsa-miR-3941	CLIP-seq
MIRT2549566	hsa-miR-409-3p	CLIP-seq
MIRT2246318	hsa-miR-4272	CLIP-seq
MIRT2549567	hsa-miR-4652-3p	CLIP-seq
MIRT2246319	hsa-miR-4666-5p	CLIP-seq
MIRT2549568	hsa-miR-4684-5p	CLIP-seq
MIRT2549569	hsa-miR-4753-3p	CLIP-seq
MIRT2549570	hsa-miR-4762-3p	CLIP-seq
MIRT2549571	hsa-miR-4766-5p	CLIP-seq
MIRT2549572	hsa-miR-4768-5p	CLIP-seq
MIRT2549573	hsa-miR-4778-5p	CLIP-seq
MIRT2549574	hsa-miR-485-3p	CLIP-seq
MIRT2549575	hsa-miR-499-3p	CLIP-seq
MIRT2549576	hsa-miR-499a-3p	CLIP-seq
MIRT2549577	hsa-miR-543	CLIP-seq
MIRT2549578	hsa-miR-570	CLIP-seq
MIRT2549579	hsa-miR-582-5p	CLIP-seq
MIRT2246320	hsa-miR-600	CLIP-seq
MIRT2246321	hsa-miR-603	CLIP-seq
MIRT2549580	hsa-miR-653	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IBA	21873635
GO:0003723	Function	RNA binding	IDA	21642987
GO:0005515	Function	Protein binding	IPI	16189514, 19008854, 19416887, 21190939, 21612406, 21642987, 25416956, 27107012, 28514442, 30833792, 31515488
GO:0005737	Component	Cytoplasm	IDA	19008854, 21642987
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0009615	Process	Response to virus	IDA	19416887
GO:0009615	Process	Response to virus	IMP	21642987
GO:0016032	Process	Viral process	IEA
GO:0019060	Process	Intracellular transport of viral protein in host cell	IDA	19008854
GO:0032091	Process	Negative regulation of protein binding	IDA	19416887
GO:0043657	Component	Host cell	IEA
GO:0045070	Process	Positive regulation of viral genome replication	IDA	19416887
GO:0045071	Process	Negative regulation of viral genome replication	IMP	19008854, 21976647
GO:0050688	Process	Regulation of defense response to virus	IEA
GO:0051097	Process	Negative regulation of helicase activity	IDA	19008854
GO:0051607	Process	Defense response to virus	IBA	21873635
GO:0060337	Process	Type I interferon signaling pathway	TAS
GO:0071357	Process	Cellular response to type I interferon	IDA	19008854
GO:0071360	Process	Cellular response to exogenous dsRNA	IDA	19008854

MIM	HGNC	e!Ensembl
147690	5407	ENSG00000185745

Protein

UniProt ID

P09914

Protein name

Antiviral innate immune response effector IFIT1 (IFIT-1) (Interferon-induced 56 kDa protein) (IFI-56K) (P56) (Interferon-induced protein with tetratricopeptide repeats 1)

Protein function

Plays a key role in the innate immune response as part of an interferon-dependent multiprotein complex, recognizing and sequestering viral RNAs that lack host-specific 2'-O-methylation at their 5' cap. By distinguishing these RNAs from host mRNA

PDB

4HOU , 5UDI , 5UDJ , 5UDK , 5UDL , 5W5H , 5W5I , 6C6K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13424	TPR_12	51 → 127		Repeat
PF13181	TPR_8	154 → 174	Tetratricopeptide repeat	Repeat

Sequence

MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAY
VKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDK
VENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAG
YAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYI
EEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI
QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAE
ENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP

Sequence length

478

Interactions

View interactions

	KEGG		Reactome
	Hepatitis C		ISG15 antiviral mechanism Interferon alpha/beta signaling

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Endometriosis	Endometriosis		20864642	ClinVar

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text Mining
AIDS Associated Nephropathy	Associate	28212619
Alternating hemiplegia of childhood	Associate	26769142
Atherosclerosis	Associate	36437453
Breast Neoplasms	Associate	23528130, 36766731
Carcinoma Hepatocellular	Associate	18715028, 37209778
Condylomata Acuminata	Associate	35131475
COVID 19	Associate	32599245, 33138195, 34185793, 34730223, 34880855, 35958619, 36656015, 36924127, 36992353, 37569398
Dermatomyositis	Associate	19877033, 32252809, 37353938
Diabetes Mellitus	Associate	35655479
Diabetes Mellitus Type 2	Associate	35655479
Encephalitis Tick Borne	Associate	37898570
Gaucher Disease	Associate	30988500
Hepatitis Chronic	Associate	28046052, 37209778
Heredodegenerative Disorders Nervous System	Associate	23684765
HIV Infections	Associate	28212619, 29026137
IgA Vasculitis	Stimulate	40590520
Infections	Stimulate	10662616
Inflammation	Associate	23684765, 23968978, 32308549
Influenza Human	Inhibit	37515100
Influenza Human	Stimulate	39591472
Lupus Erythematosus Cutaneous	Associate	34081040, 35356994
Lupus Erythematosus Systemic	Associate	23623029, 29257335, 34079550, 35967341
Lupus Erythematosus Systemic	Stimulate	26531267
Lupus Nephritis	Associate	34782453
Malocclusion Angle Class III	Stimulate	34782453
Microscopic Polyangiitis	Associate	23690996, 28569178
Mouth Neoplasms	Associate	34384424
Mucocutaneous Lymph Node Syndrome	Stimulate	40590520
Myelodysplastic Syndromes	Associate	16527891
Nemaline myopathy 5	Associate	23528130
Neoplasms	Associate	23528130, 26769142, 33431054, 34791638
Obesity	Associate	26252510, 29578204
Osteoporosis	Associate	33061329
Pancreatic Neoplasms	Stimulate	34791638
Respiratory Distress Syndrome	Associate	36918848
Scleroderma Systemic	Associate	33253099
Sjogren's Syndrome	Associate	35958619, 37832090, 39331939
Thyroid Neoplasms	Associate	37817224
Triple Negative Breast Neoplasms	Associate	23528130
Tuberculosis Pulmonary	Stimulate	35568895
Virus Diseases	Stimulate	10662616
Virus Diseases	Associate	22792062

IFIT1 (interferon induced protein with tetratricopeptide repeats 1)