Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	340061
Gene name	Stimulator of interferon response cGAMP interactor 1
Gene symbol	STING1
Synonyms (NCBI Gene)	ERISMITAMPYSNET23SAVISTINGSTING-betaTMEM173hMITAhSTING
Chromosome	5
Chromosome location	5q31.2
Summary	This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits si

Show/Hide all (5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs140011636	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, intron variant, missense variant
rs587777609	T>C	Pathogenic	Coding sequence variant, missense variant
rs587777610	C>T	Pathogenic	Coding sequence variant, missense variant
rs587777611	C>G	Pathogenic	Coding sequence variant, missense variant
rs1561482476	C>T	Pathogenic	Downstream transcript variant, coding sequence variant, genic downstream transcript variant, intron variant, missense variant

123

Show/Hide all (123)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000045	Process	Autophagosome assembly	IDA	23202584
GO:0000045	Process	Autophagosome assembly	IDA	30568238, 30842662, 37535724
GO:0000045	Process	Autophagosome assembly	IEA
GO:0000139	Component	Golgi membrane	IDA	37535724
GO:0000139	Component	Golgi membrane	IDA	29973723
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000421	Component	Autophagosome membrane	IEA
GO:0002218	Process	Activation of innate immune response	IBA
GO:0002218	Process	Activation of innate immune response	IDA	23910378
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002221	Process	Pattern recognition receptor signaling pathway	IDA	23910378
GO:0002230	Process	Positive regulation of defense response to virus by host	IMP	18818105
GO:0002376	Process	Immune system process	IEA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	29441066
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	23910378, 35388221
GO:0003713	Function	Transcription coactivator activity	IDA	18818105
GO:0005515	Function	Protein binding	IPI	18724357, 18818105, 19416887, 19433799, 20080758, 20628368, 20890285, 21903422, 22000020, 22312431, 22908223, 22911572, 23542348, 24560620, 24622840, 25299331, 26405230, 27302953, 29251827, 29429998, 30104205, 30842662, 32296183, 35013224
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	18818105
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005768	Component	Endosome	IDA	29694889
GO:0005776	Component	Autophagosome	IBA
GO:0005776	Component	Autophagosome	IDA	29694889
GO:0005776	Component	Autophagosome	IEA
GO:0005777	Component	Peroxisome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	37832545
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	19433799, 25254379, 29694889, 30119996, 30842659, 30842662
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	33833439
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IDA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006914	Process	Autophagy	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0015252	Function	Proton channel activity	IDA	37535724
GO:0016020	Component	Membrane	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IBA
GO:0016239	Process	Positive regulation of macroautophagy	IDA	30568238, 30842662, 37535724
GO:0016239	Process	Positive regulation of macroautophagy	IEA
GO:0019222	Process	Regulation of metabolic process	IEA
GO:0019901	Function	Protein kinase binding	IDA	18818105
GO:0019901	Function	Protein kinase binding	IPI	21074459
GO:0023019	Process	Signal transduction involved in regulation of gene expression	TAS	37403426
GO:0030659	Component	Cytoplasmic vesicle membrane	TAS
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IBA
GO:0032481	Process	Positive regulation of type I interferon production	IDA	14703513, 18636090, 25636800
GO:0032481	Process	Positive regulation of type I interferon production	IDA	22394562, 23747010, 25636800, 26669264, 29694889, 29973723, 30842659, 35388221, 37832545
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0032527	Process	Protein exit from endoplasmic reticulum	IDA	32690950, 37832545
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	21074459, 25254379
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	19433799
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IDA	32690950, 37832545
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IDA	30842662
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0035438	Function	Cyclic-di-GMP binding	IBA
GO:0035438	Function	Cyclic-di-GMP binding	IDA	22705373, 29694889
GO:0035438	Function	Cyclic-di-GMP binding	IEA
GO:0035458	Process	Cellular response to interferon-beta	IEA
GO:0035591	Function	Signaling adaptor activity	IDA	23747010, 25636800, 37832545
GO:0036064	Component	Ciliary basal body	IDA
GO:0042802	Function	Identical protein binding	IPI	19433799, 22312431, 22728658, 22728659, 22728660, 23542348, 30405246, 30842659
GO:0042803	Function	Protein homodimerization activity	IDA	19433799, 21074459, 22705373
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	21074459, 23910378, 25254379
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	18818105, 19433799
GO:0045087	Process	Innate immune response	TAS	37403426
GO:0045087	Process	Innate immune response	TAS	37403426
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18818105
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0051259	Process	Protein complex oligomerization	IDA	35388221
GO:0051259	Process	Protein complex oligomerization	IDA	30842659
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IDA	21074459, 25254379
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	NAS	24622840
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IDA	23910378
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IEA
GO:0061507	Function	2',3'-cyclic GMP-AMP binding	IBA
GO:0061507	Function	2',3'-cyclic GMP-AMP binding	IDA	23747010, 26669264, 30842659, 30842662, 35388221
GO:0061507	Function	2',3'-cyclic GMP-AMP binding	IEA
GO:0061507	Function	2',3'-cyclic GMP-AMP binding	ISS
GO:0061507	Function	2',3'-cyclic GMP-AMP binding	TAS	37403426
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	18818105
GO:0061709	Process	Reticulophagy	IBA
GO:0061709	Process	Reticulophagy	IEA
GO:0061709	Process	Reticulophagy	ISS
GO:0070972	Process	Protein localization to endoplasmic reticulum	IDA	37832545
GO:0070972	Process	Protein localization to endoplasmic reticulum	IDA	37832545
GO:0071360	Process	Cellular response to exogenous dsRNA	IMP	18818105
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	18818105
GO:0140374	Process	Antiviral innate immune response	IDA	22394562
GO:0140374	Process	Antiviral innate immune response	IDA	21074459
GO:0140896	Process	CGAS/STING signaling pathway	IDA	25636800
GO:0140896	Process	CGAS/STING signaling pathway	IDA	25636800, 30842659, 30842662, 35388221, 37832545
GO:0140896	Process	CGAS/STING signaling pathway	IEA
GO:0140896	Process	CGAS/STING signaling pathway	TAS	37403426
GO:0140896	Process	CGAS/STING signaling pathway	TAS	37403426
GO:0141111	Process	Positive regulation of cGAS/STING signaling pathway	IDA	37832545
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	TAS	37403426
GO:1902554	Component	Serine/threonine protein kinase complex	NAS	24622840
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1990231	Component	STING complex	IEA
GO:1990231	Component	STING complex	IPI	30405246

MIM	HGNC	e!Ensembl
612374	27962	ENSG00000184584

Q86WV6

Protein name

Stimulator of interferon genes protein (hSTING) (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (hMITA) (Transmembrane protein 173)

Protein function

Facilitator of innate immune signaling that acts as a sensor of cytosolic DNA from bacteria and viruses and promotes the production of type I interferon (IFN-alpha and IFN-beta) (PubMed:18724357, PubMed:18818105, PubMed:19433799, PubMed:19776740

PDB

4EF4 , 4EF5 , 4EMT , 4EMU , 4F5D , 4F5E , 4F5W , 4F5Y , 4F9E , 4F9G , 4KSY , 4LOH , 4LOI , 4QXO , 4QXP , 4QXQ , 4QXR , 5BQX , 5JEJ , 6CFF , 6CY7 , 6DNK , 6DXG , 6DXL , 6MX0 , 6MX3 , 6MXE , 6NT5 , 6O8B , 6O8C , 6S26 , 6S27 , 6S86 , 6UKM , 6UKU , 6UKV , 6UKW , 6UKX , 6UKY , 6UKZ , 6UL0 , 6XF3 , 6XF4 , 6XNP , 6Y99 , 6YDB , 6YDZ , 6YEA , 6YWA , 6YWB , 6Z0Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15009	TMEM173	44 → 337	Transmembrane protein 173	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed (PubMed:18724357, PubMed:18818105). Expressed in skin endothelial cells, alveolar type 2 pneumocytes, bronchial epithelium and alveolar macrophages (PubMed:25029335). {ECO:0000269|PubMed:18724357, ECO:0000269|Pub

Sequence

MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL
NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM
LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY
SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQE
PELLISGMEKPLPLRTDFS

Sequence length

379

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway Shigellosis Human cytomegalovirus infection Herpes simplex virus 1 infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19		STING mediated induction of host immune responses Regulation of innate immune responses to cytosolic DNA STAT6-mediated induction of chemokines IRF3-mediated induction of type I IFN Neutrophil degranulation

361

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
STING-associated vasculopathy with onset in infancy	Likely pathogenic; Pathogenic	rs2152094234, rs587777609, rs587777610, rs587777611, rs2547062066, rs2547063045, rs2547063044, rs1561482476	RCV001730166 RCV000133400 RCV000133401 RCV000133402 RCV002847646 RCV003335870 RCV003842903 RCV000689142

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Likely benign	rs11554777	RCV005906317
Autoinflammatory syndrome	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	rs772018436, rs7380824, rs11554776, rs143322684, rs117897081, rs768799195, rs765347385, rs1215030543, rs2152094475, rs763523329, rs760161824, rs1392211552, rs2152094379, rs1033930953, rs375733291 View all (28 more)	RCV002264345 RCV002264366 RCV002264370 RCV002264386 RCV002264481 RCV002264482 RCV002264519 RCV002264520 RCV002264521 RCV002264522 RCV002264523 RCV002264524 RCV002264525 RCV002264526 RCV002264527 RCV002264528 RCV002264529 RCV002264530 RCV002264531 RCV002264532 RCV002264533 RCV002264534 RCV002264535 RCV002264536 RCV002263800 RCV002263803 RCV002263802 RCV002263801 RCV002263799 RCV002263911 RCV002263912 RCV002263913 RCV002263964 RCV002263977 RCV002263983 RCV002264011 RCV002264002 RCV002264046 RCV002264065 RCV002264151 RCV002264233 RCV002264221 RCV002264248
Clear cell carcinoma of kidney	Uncertain significance	rs746371007, rs781602496	RCV005869758 RCV005869759
Familial cancer of breast	Likely benign; Uncertain significance; Benign	rs200232916, rs199795457, rs11554777	RCV005900348 RCV005900347 RCV005906316
Gastric cancer	Benign; Likely benign	rs11554777	RCV005906319
Hepatocellular carcinoma	Benign; Likely benign	rs11554777	RCV005906318
Lung cancer	Likely benign	rs200232916	RCV005900349
STING1-related disorder	Likely benign; Conflicting classifications of pathogenicity; Benign	rs147482780, rs201096097, rs114834699, rs142609349, rs149842998, rs140011636, rs11554777	RCV003973579 RCV003905453 RCV003915632 RCV003915631 RCV003945669 RCV003905771 RCV003910660

Show/Hide Text Mining Associations (186)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
3 methylcrotonyl CoA carboxylase 1 deficiency	Inhibit	32482869
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	32482869
Abortion Habitual	Associate	37298501, 38012139
Acquired Immunodeficiency Syndrome	Associate	30956171
Adenocarcinoma	Associate	35099823, 36550819
Adenocarcinoma of Lung	Associate	31221150, 32068166, 32654272, 35273829, 35978045, 37643778, 37667220
Adenomyosis	Stimulate	32046461
Adenomyosis	Associate	34010983
Alopecia	Associate	31866997, 38178067
Alzheimer Disease	Associate	37221295, 38049398, 39753133
Aneuploidy	Associate	34215848
Anophthalmia with pulmonary hypoplasia	Associate	35773436
Aortic Aneurysm Thoracic	Associate	35510553
Arthritis	Associate	25029335
Arthritis Juvenile	Associate	33162473
Arthritis Psoriatic	Inhibit	35470716
Arthritis Rheumatoid	Stimulate	35470716
Ataxia Telangiectasia	Associate	34459078
Atherosclerosis	Associate	36598778
Atrophy	Associate	36030554
Attention Deficit and Disruptive Behavior Disorders	Associate	37931834
Autoimmune Diseases	Associate	27512060, 27835584, 28806404, 29558821, 31665637, 35644988, 37129502, 37794597, 37802125, 38178067
Bacterial Infections	Associate	27814372, 31866997, 34016129, 36445063
Blood Coagulation Disorders	Associate	37120444
Brain Neoplasms	Inhibit	37586773
Breast Neoplasms	Inhibit	24239807
Breast Neoplasms	Associate	27707838, 27791205, 34728791, 37612508, 38117852, 39185402, 39967410, 40311680
Carcinogenesis	Inhibit	24239807, 36445063
Carcinogenesis	Associate	28566766, 29496049, 35415876, 37355491, 37586363, 37667220, 38238314
Carcinoma Hepatocellular	Associate	27814372, 33006365
Carcinoma Merkel Cell	Associate	32482869
Carcinoma Merkel Cell	Inhibit	36498833
Carcinoma Non Small Cell Lung	Associate	34216619, 35099823, 35346313, 35415876, 35429143, 37495171, 39308524
Carcinoma Pancreatic Ductal	Associate	37195712
Carcinoma Renal Cell	Associate	35983076, 36445063, 37120444, 37319163
Carcinoma Small Cell	Associate	32068166, 35978199
Carcinoma Squamous Cell	Associate	32068166
Carnevale syndrome	Associate	37079538
Cataract Age Related Nuclear	Associate	39209536
CD59 Deficiency	Associate	36030554
Chilblain lupus 1	Associate	31866997, 32293470
Chromosomal Instability	Stimulate	36923311, 37612508
Chromosomal Instability	Associate	37806895, 38167338
Chromosome Disorders	Associate	37640708
Colitis Ulcerative	Associate	36165492
Colonic Neoplasms	Associate	26133168, 37108510, 38065948
Colorectal Neoplasms	Associate	31439450, 31869529, 35749909, 37355491, 37443289
Colorectal Neoplasms	Stimulate	35429245
Communicable Diseases	Associate	34016129, 37802125, 37945588
COVID 19	Inhibit	24622840
COVID 19	Stimulate	34193364
COVID 19	Associate	34674770, 35933402
Cryptorchidism	Associate	38466010
Crystal Arthropathies	Stimulate	35470716
Cytokine Release Syndrome	Associate	25790474, 37794597
Death	Associate	34462421
Dental Caries	Stimulate	34016129
Dermatomyositis	Associate	36030554
Diabetes Mellitus Type 1	Associate	32398023
Diabetes Mellitus Type 2	Associate	36139069
DNA Virus Infections	Stimulate	27707838
DNA Virus Infections	Associate	30589644, 35957613
Down Syndrome	Associate	34215848
Drug Related Side Effects and Adverse Reactions	Associate	37079538, 37986544
Dysmenorrhea	Associate	34010983
Encephalitis Japanese	Associate	22470840
Encephalitis Viral	Associate	22470840
Encephalomyelitis Autoimmune Experimental	Associate	33291536
Endodermal Sinus Tumor	Associate	37986544
Endometrial Neoplasms	Associate	32046461, 36509095
Endometriosis	Stimulate	32046461
Endometriosis	Inhibit	36509095
Epstein Barr Virus Infections	Stimulate	35611665
Erythema	Associate	31866997
Esophageal Squamous Cell Carcinoma	Associate	25129146
Factor X Deficiency	Associate	31371933
Fibrosis	Stimulate	31745210
Glioblastoma	Associate	37219874, 37931834, 38214828
Glioma	Associate	36267817, 37219874
Head and Neck Neoplasms	Associate	29496049, 37834346, 38147007
Heat Stroke	Associate	38466010
Hereditary Autoinflammatory Diseases	Associate	26593864, 29638206, 33042144, 35470716, 38118407, 38178067
Herpes Simplex	Associate	27512060
Hidradenitis Suppurativa	Associate	32240121
HIV Infections	Associate	31867020, 33858455
Huntington Disease	Associate	38498709
Hypersensitivity Immediate	Associate	31866997, 33291536
Hypertension Pulmonary	Associate	31144250
Hypoxia	Stimulate	37931834
Idiopathic inflammatory myopathy familial	Associate	25401470
Immune System Diseases	Associate	36336725
Immunologic Deficiency Syndromes	Associate	38178067
Infections	Inhibit	29813068
Infections	Associate	34203706, 34506598, 36746947, 37652009
Inflammation	Associate	22470840, 25029335, 28806404, 30936263, 31068249, 31346090, 31371933, 31529615, 31866997, 31941397, 32046461, 32240121, 32482869, 32546974, 34016129 View all (23 more)
Inflammation	Stimulate	31745210, 32169869
Intellectual Disability	Associate	36445063
Intervertebral Disc Degeneration	Stimulate	32546974
Joint Diseases	Associate	35470716
Kidney Diseases	Associate	31144250, 33217613
Leukemia Biphenotypic Acute	Stimulate	37095455
Lichen Planus Oral	Associate	34506598, 35493447
Lichen Planus Oral	Stimulate	35644988
Livedo Reticularis	Associate	31866997
Livedoid Vasculopathy	Associate	25029335, 29649002, 31144250, 31601430, 31866997, 31969166, 33162473, 37864791, 37884945, 38118407, 40222637
Lung Diseases	Associate	31144250, 33162473, 33833757
Lung Diseases Interstitial	Associate	31144250, 31969166, 32398023, 33162473, 33217613, 37884945, 40222637
Lung Diseases Interstitial	Stimulate	32602227
Lung Neoplasms	Associate	30297358, 33013881, 35273829, 36220070, 37167549
Lung Neoplasms	Inhibit	35794238, 35978045, 36150391
Lupus Erythematosus Systemic	Associate	25401470, 39306342, 40222637
Lupus Erythematosus Systemic	Stimulate	37129502
Lupus Vasculitis Central Nervous System	Associate	39306342
Lymphatic Metastasis	Inhibit	28176788
Lymphohistiocytosis Hemophagocytic	Associate	38277122
Lymphoma Large B Cell Diffuse	Associate	37138342, 37781035
Macrophage Activation Syndrome	Associate	35467709, 35924849
Macrophage Activation Syndrome	Stimulate	37298501
Macular Degeneration	Associate	31371933
Melanoma	Associate	31462408, 33827917, 35131084, 37612508, 37945588, 38239354, 39933900
Mesothelioma	Associate	35678717
Mesothelioma Malignant	Associate	35678717
Mitochondrial Diseases	Stimulate	30297358, 34216619, 36150391, 37236195
Mucocutaneous Lymph Node Syndrome	Associate	34193364
Multiple Pterygium Syndrome Autosomal Dominant	Associate	32398023
Multiple Sclerosis	Associate	33291536
Multiple Sclerosis Relapsing Remitting	Associate	33291536
Muscular Disorders Atrophic	Associate	36030554
Mycosis Fungoides	Stimulate	35882970
Myositis	Stimulate	36030554
Myotonic Dystrophy	Associate	37223012
Nasal Septal Perforation	Associate	31866997
Nasopharyngeal Carcinoma	Inhibit	30816302
Necrosis	Associate	36030554
Neoplasm Metastasis	Associate	37120444, 37612508, 37667220, 38167338
Neoplasms	Inhibit	24239807, 27814372, 28176788, 32755577, 34138519, 35131084, 35794238, 37443289
Neoplasms	Associate	26133168, 27835584, 28981114, 29064738, 30080846, 30193098, 30816302, 31439450, 31462408, 31662325, 32068166, 32169869, 32482869, 32768338, 33013881 View all (50 more)
Neoplasms	Stimulate	37120444
Neoplasms Cystic Mucinous and Serous	Stimulate	34138519
Nephrotic Syndrome	Associate	37406004
Neuroblastoma	Associate	32169869
Neurodegenerative Diseases	Associate	34459078
Neuroinflammatory Diseases	Associate	33291536
Neurotoxicity Syndromes	Associate	35262626, 38290197
Non alcoholic Fatty Liver Disease	Associate	31745210, 34828420
Osteoarthritis	Stimulate	31068249
Osteoarthritis	Associate	35799274
Osteosarcoma	Associate	28179534, 34216619, 35662245
Ovarian Neoplasms	Associate	34138519, 38373690
Pancreatic Neoplasms	Associate	34203706, 34462421, 35773436, 37195712, 37330147, 37547756
Papillomavirus Infections	Associate	27705945
Parkinson Disease	Associate	35657605
pediatric multisystem inflammatory disease COVID 19 related	Associate	34193364
Peripheral Vascular Diseases	Associate	33833757
Peritonitis	Associate	35022662
Pheochromocytoma	Associate	35983076
Pneumonia	Associate	25029335, 37406004
Prostatic Neoplasms	Associate	33899001, 37581614, 38057852, 40532290
Pulmonary Disease Chronic Obstructive	Associate	37406004
Pulpitis	Associate	34016129
Recombinant chromosome 8 syndrome	Associate	34047476, 34158843, 37063431
Rectal Neoplasms	Associate	38035726
Respiratory Tract Infections	Associate	31144250
Rheumatic Diseases	Associate	35470716
Skin Diseases	Associate	31144250
Small Cell Lung Carcinoma	Associate	35794238, 35957613, 35978199, 39722014
Spastic Paraplegia Hereditary	Associate	36739287
Spinal Cord Injuries	Associate	38009491
Squamous Cell Carcinoma of Head and Neck	Associate	29496049, 32768338, 34625078, 37834346, 38147007
Squamous Intraepithelial Lesions	Inhibit	24614210
Still's Disease Adult Onset	Associate	35467709
Stomach Neoplasms	Associate	28176788, 35611665, 39242811
Syndrome	Associate	35484149
Thyroid Diseases	Associate	31866997
Tissue Adhesions	Associate	40147728
Triple Negative Breast Neoplasms	Stimulate	31662325
Triple Negative Breast Neoplasms	Associate	34583980, 39967410
Tuberculosis	Stimulate	39232642
Tuberculosis Spinal	Associate	39232642
Urinary Bladder Neoplasms	Associate	34116604, 36923311, 37670034
Uterine Cervical Neoplasms	Associate	24614210, 33040406
Uterine Diseases	Associate	34010983
Varicella Zoster Virus Infection	Associate	38277122
Vascular System Injuries	Associate	25029335
Vasculitis	Associate	31866997
Virus Diseases	Associate	27814372, 34203706, 35765167, 36445063, 36946735, 37298501, 37945588

STING1 (stimulator of interferon response cGAMP interactor 1)