ID4 (inhibitor of DNA binding 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 3400
Gene name Inhibitor of DNA binding 4
Gene symbol ID4
Synonyms (NCBI Gene)
IDB4bHLHb27
Chromosome 6
Chromosome location 6p22.3
Summary This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This prote
miRNA miRNA information provided by mirtarbase database.
492
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (492)
miRTarBase ID miRNA Experiments Reference
MIRT016169 hsa-miR-590-3p Sequencing 20371350
MIRT018452 hsa-miR-335-5p Reporter assay;Western blot;Other 21618216
MIRT019630 hsa-miR-340-5p Sequencing 20371350
MIRT021484 hsa-miR-9-5p Sequencing 20371350
MIRT022878 hsa-miR-124-3p Microarray 18668037
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (3)
Transcription factor Regulation Reference
SP1 Repression 9516472
SP3 Repression 9516472
USF1 Unknown 9516472
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
44
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (44)
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 7665172
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
600581 5363 ENSG00000172201
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P47928
Protein name DNA-binding protein inhibitor ID-4 (Class B basic helix-loop-helix protein 27) (bHLHb27) (Inhibitor of DNA binding 4) (Inhibitor of differentiation 4)
Protein function Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 64 → 105 Helix-loop-helix DNA-binding domain Domain
Sequence 
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEP
ALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Sequence length 161
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells 		  NGF-stimulated transcription