ID4 (inhibitor of DNA binding 4)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3400
Gene name Gene Name - the full gene name approved by the HGNC.
Inhibitor of DNA binding 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ID4
Synonyms (NCBI Gene) Gene synonyms aliases
IDB4, bHLHb27
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This prote
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(492)
miRTarBase ID miRNA Experiments Reference
MIRT016169 hsa-miR-590-3p Sequencing 20371350
MIRT018452 hsa-miR-335-5p Reporter assay;Western blot;Other 21618216
MIRT019630 hsa-miR-340-5p Sequencing 20371350
MIRT021484 hsa-miR-9-5p Sequencing 20371350
MIRT022878 hsa-miR-124-3p Microarray 18668037
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
SP1 Repression 9516472
SP3 Repression 9516472
USF1 Unknown 9516472
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA 21873635
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 7665172
GO:0005515 Function Protein binding IPI 17474147, 32814053
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IC 11136250
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600581 5363 ENSG00000172201
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P47928
Protein name DNA-binding protein inhibitor ID-4 (Class B basic helix-loop-helix protein 27) (bHLHb27) (Inhibitor of DNA binding 4) (Inhibitor of differentiation 4)
Protein function Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 64 → 105 Helix-loop-helix DNA-binding domain Domain
Sequence 
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEP
ALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Sequence length 161
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells 		  NGF-stimulated transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Carcinoma Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 14633621
Cholestasis Cholestasis rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039 27989131
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)		 16367923
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma GWAS
Show/Hide Text Mining Associations (54)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 18831746
Adenocarcinoma of Lung Associate 34723712
Adrenoleukodystrophy Associate 29476661
Astrocytoma Associate 23613880
Blast Crisis Associate 28452111
Breast Neoplasms Associate 11136250, 16582598, 17998253, 18513385, 24475217, 26464711, 26610810, 28652379, 29921315, 30066902, 30139383
Breast Neoplasms Inhibit 27302063
Breast Neoplasms Stimulate 32054109
Carcinogenesis Associate 18513385, 23342268, 24343358
Carcinoma Associate 24718460