BRINP3 (BMP/retinoic acid inducible neural specific 3)

Gene

• Entrez ID: 339479
• Gene name: BMP/retinoic acid inducible neural specific 3
• Gene symbol: BRINP3
• Synonyms (NCBI Gene): DBCCR1L, DBCCR1L1, FAM5C
• Chromosome: 1
• Chromosome location: 1q31.1
• Summary: This gene is overexpressed in pituitary tumors but is underexpressed in tongue squamous cell carcinomas, ulcerative colitis, and peri-implantitis. Polymorphisms that increase expression of this gene have been shown to increase vascular inflammation, and a

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IBA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0021953	Process	Central nervous system neuron differentiation	ISS
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0035176	Process	Social behavior	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0035640	Process	Exploration behavior	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IBA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	ISS
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0071300	Process	Cellular response to retinoic acid	IBA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071300	Process	Cellular response to retinoic acid	ISS

Other IDs

• MIM: 618390
• HGNC: 22393
• e!Ensembl: ENSG00000162670

Protein

• UniProt ID: Q76B58
• Protein name: BMP/retinoic acid-inducible neural-specific protein 3 (DBCCR1-like protein 1)
• Protein function: Inhibits neuronal cell proliferation by negative regulation of the cell cycle transition. Promotes pituitary gonadotrope cell proliferation, migration and invasion, when overexpressed. May play a role in cell pituitary tumor development. {ECO:00
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01823	MACPF	52 → 207	MAC/Perforin domain	Domain
  PF19052	BRINP	319 → 766	BMP/retinoic acid-inducible neural-specific protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Strongly expressed in oral keratinocytes compared to the weak expression in tongue squamous cell carcinoma (SCC). Expressed in endothelial and aortic smooth muscle cells. Overexpressed in gonadotropinomas compared to normal pituitarie
• Sequence:

  MIWRSRAGAELFSLMALWEWIALSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEY
  TDFVDRSRQGFSTRYKIYREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTL
  QQITENLIKKYGTHFLLSATLGGEESLTIFVDKRKLSKRAEGSDSTTNSSSVTLETLHQL
  AASYFIDRDSTLRRLHHIQIASTAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKIQL
  QGLQVLLPDYLQERFVQAALSYIACNSEGEFICKENDCWCHCGPKFPECNCPSMDIQAME
  ENLLRITETWKAYNSDFEESDEFKLFMKRLPMNYFLNTSTIMHLWTMDSNFQRRYEQLEN
  SMKQLFLKAQKIVHKLFSLSKRCHKQPLISLPRQRTSTYWLTRIQSFLYCNENGLLGSFS
  EETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTRCGTCNTGYMLSQGLCKPEVAE
  STDHYIGFETDLQDLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSN
  KYKSSLVHMILGLSLQICLTKNSTLEPVLAVYVNPFGGSHSESWFMPVNENSFPDWERTK
  LDLPLQCYNWTLTLGNKWKTFFETVHIYLRSRIKSNGPNGNESIYYEPLEFIDPSRNLGY
  MKINNIQVFGYSMHFDPEAIRDLILQLDYPYTQGSQDSALLQLLEIRDRVNKLSPPGQRR
  LDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTMDYDTTKLCS

• Sequence length: 766