CLEC4G (C-type lectin domain family 4 member G)

Gene

• Entrez ID: 339390
• Gene name: C-type lectin domain family 4 member G
• Gene symbol: CLEC4G
• Synonyms (NCBI Gene): DTTR431, LP2698, LSECtin, UNQ431
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: This gene encodes a glycan-binding receptor and member of the C-type lectin family which plays a role in the immune response. C-type lectin receptors are pattern recognition receptors located on immune cells that play a role in the recognition and uptake

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025828	hsa-miR-7-5p	Microarray	17612493
MIRT896110	hsa-miR-1321	CLIP-seq
MIRT896111	hsa-miR-1587	CLIP-seq
MIRT896112	hsa-miR-3147	CLIP-seq
MIRT896113	hsa-miR-3652	CLIP-seq
MIRT896114	hsa-miR-4270	CLIP-seq
MIRT896115	hsa-miR-4425	CLIP-seq
MIRT896116	hsa-miR-4430	CLIP-seq
MIRT896117	hsa-miR-4441	CLIP-seq
MIRT896118	hsa-miR-4492	CLIP-seq
MIRT896119	hsa-miR-4498	CLIP-seq
MIRT896120	hsa-miR-4520a-3p	CLIP-seq
MIRT896121	hsa-miR-4638-3p	CLIP-seq
MIRT896122	hsa-miR-4640-5p	CLIP-seq
MIRT896123	hsa-miR-4656	CLIP-seq
MIRT896124	hsa-miR-4675	CLIP-seq
MIRT896125	hsa-miR-4726-5p	CLIP-seq
MIRT896126	hsa-miR-4739	CLIP-seq
MIRT896127	hsa-miR-4741	CLIP-seq
MIRT896128	hsa-miR-4756-5p	CLIP-seq
MIRT896129	hsa-miR-4781-3p	CLIP-seq
MIRT896130	hsa-miR-665	CLIP-seq
MIRT896131	hsa-miR-762	CLIP-seq
MIRT1965679	hsa-miR-2115	CLIP-seq
MIRT1965680	hsa-miR-3155	CLIP-seq
MIRT1965681	hsa-miR-3155b	CLIP-seq
MIRT1965682	hsa-miR-484	CLIP-seq
MIRT1965683	hsa-miR-516a-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYB	Activation	19111020
RUNX3	Activation	19111020
SPI1	Activation	19111020

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	22156524
GO:0001618	Function	Virus receptor activity	IEA
GO:0002456	Process	T cell mediated immunity	IEA
GO:0002710	Process	Negative regulation of T cell mediated immunity	IEA
GO:0005515	Function	Protein binding	IPI	18624398, 32296183, 33106485
GO:0005537	Function	D-mannose binding	IDA	14711836
GO:0005886	Component	Plasma membrane	IDA	14711836
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030246	Function	Carbohydrate binding	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030247	Function	Polysaccharide binding	IEA
GO:0033080	Process	Immature T cell proliferation in thymus	IEA
GO:0033088	Process	Negative regulation of immature T cell proliferation in thymus	IEA
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0046633	Process	Alpha-beta T cell proliferation	IEA
GO:0046642	Process	Negative regulation of alpha-beta T cell proliferation	IEA
GO:0046718	Process	Symbiont entry into host cell	IDA	16051304, 24623090
GO:0070061	Function	Fructose binding	IDA	14711836
GO:0097367	Function	Carbohydrate derivative binding	IDA	14711836
GO:0120274	Function	Virus coreceptor activity	IGI	16051304
GO:0140081	Function	Glycosylated region protein binding	ISS
GO:1903902	Process	Positive regulation of viral life cycle	IMP	22673088

Other IDs

• MIM: 616256
• HGNC: 24591
• e!Ensembl: ENSG00000182566

Protein

• UniProt ID: Q6UXB4
• Protein name: C-type lectin domain family 4 member G (Liver and lymph node sinusoidal endothelial cell C-type lectin) (LSECtin)
• Protein function: Binds mannose, N-acetylglucosamine (GlcNAc) and fucose, but not galactose, in a Ca(2+)-dependent manner, in vitro. ; (Microbial infection) Acts as a receptor for Japanese encephalitis virus. {ECO:0000269|P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	182 → 289	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed exclusively in fetal and adult liver and in lymph nodes. Specifically expressed by endothelial cells lining lymph node and liver sinuses (at protein level). {ECO:0000269|PubMed:14711836}.
• Sequence:

  MDTTRYSKWGGSSEEVPGGPWGRWVHWSRRPLFLALAVLVTTVLWAVILSILLSKASTER
  AALLDGHDLLRTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQE
  SALRELRERVTQGLAEAGRGREDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFS
  VPKTTWAAAQDHCADASAHLVIVGGLDEQGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWV
  DGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKRHNC

• Sequence length: 293

Pathways

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell