Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
339390
Gene name Gene Name - the full gene name approved by the HGNC.
C-type lectin domain family 4 member G
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLEC4G
Synonyms (NCBI Gene) Gene synonyms aliases
DTTR431, LP2698, LSECtin, UNQ431
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a glycan-binding receptor and member of the C-type lectin family which plays a role in the immune response. C-type lectin receptors are pattern recognition receptors located on immune cells that play a role in the recognition and uptake
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025828 hsa-miR-7-5p Microarray 17612493
MIRT896110 hsa-miR-1321 CLIP-seq
MIRT896111 hsa-miR-1587 CLIP-seq
MIRT896112 hsa-miR-3147 CLIP-seq
MIRT896113 hsa-miR-3652 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
MYB Activation 19111020
RUNX3 Activation 19111020
SPI1 Activation 19111020
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IDA 22156524
GO:0001618 Function Virus receptor activity IEA
GO:0002456 Process T cell mediated immunity IEA
GO:0002710 Process Negative regulation of T cell mediated immunity IEA
GO:0005515 Function Protein binding IPI 18624398, 32296183, 33106485
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616256 24591 ENSG00000182566
Protein
UniProt ID Q6UXB4
Protein name C-type lectin domain family 4 member G (Liver and lymph node sinusoidal endothelial cell C-type lectin) (LSECtin)
Protein function Binds mannose, N-acetylglucosamine (GlcNAc) and fucose, but not galactose, in a Ca(2+)-dependent manner, in vitro. ; (Microbial infection) Acts as a receptor for Japanese encephalitis virus. {ECO:0000269|P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 182 289 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed exclusively in fetal and adult liver and in lymph nodes. Specifically expressed by endothelial cells lining lymph node and liver sinuses (at protein level). {ECO:0000269|PubMed:14711836}.
Sequence
MDTTRYSKWGGSSEEVPGGPWGRWVHWSRRPLFLALAVLVTTVLWAVILSILLSKASTER
AALLDGHDLLRTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQE
SALRELRERVTQGLAEAGRGREDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFS
VPKTTWAAAQDHCADASAHLVIVGGLDEQGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWV
DGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEK
RHNC
Sequence length 293
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
<