Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
338339
Gene name Gene Name - the full gene name approved by the HGNC.
C-type lectin domain family 4 member D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLEC4D
Synonyms (NCBI Gene) Gene synonyms aliases
CD368, CLEC-6, CLEC6, CLECSF8, Dectin-3, MCL, MPCL
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021599 hsa-miR-142-3p Microarray 17612493
MIRT049934 hsa-miR-30a-5p CLASH 23622248
MIRT611584 hsa-miR-8485 HITS-CLIP 23824327
MIRT611583 hsa-miR-329-3p HITS-CLIP 23824327
MIRT611582 hsa-miR-362-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway TAS
GO:0002250 Process Adaptive immune response IEA
GO:0005515 Function Protein binding IPI 25910212, 32296183
GO:0005886 Component Plasma membrane TAS
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609964 14554 ENSG00000166527
Protein
UniProt ID Q8WXI8
Protein name C-type lectin domain family 4 member D (C-type lectin superfamily member 8) (C-type lectin-like receptor 6) (CLEC-6) (Dendritic cell-associated C-type lectin 3) (DC-associated C-type lectin 3) (Dectin-3) (CD antigen CD368)
Protein function Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of pathogen-associated molecular patterns (PAMPs) of bacteria and fungi (PubMed:23602
PDB 2LS8 , 3WHD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 101 209 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed weakly in peripheral blood leukocytes, bone marrow and spleen. Expression is confined mostly in monocytes and macrophage and seems to be up-regulated by IL-6, IL-10, TNF-alpha and IFN-gamma. {ECO:0000269|PubMed:14971047}.
Sequence
MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEH
HAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLM
TISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGE
NCVVLVYNQDKWAWNDVPCNFEASRICKI
PGTTLN
Sequence length 215
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  C-type lectin receptor signaling pathway   Dectin-2 family
Neutrophil degranulation