Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3362
Gene name Gene Name - the full gene name approved by the HGNC.	5-hydroxytryptamine receptor 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HTR6
Synonyms (NCBI Gene) Gene synonyms aliases	5-HT6, 5-HT6R
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.13
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that belongs to the seven-transmembrane G protein-coupled receptor family of proteins. The encoded protein couples with the Gs alpha subunit and stimulates adenylate cyclase to activate the cyclic AMP-dependent signaling pathwa

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments
MIRT2013104	hsa-miR-1182	CLIP-seq
MIRT2013105	hsa-miR-767-3p	CLIP-seq
MIRT2013104	hsa-miR-1182	CLIP-seq
MIRT2245381	hsa-miR-1266	CLIP-seq
MIRT2245382	hsa-miR-4518	CLIP-seq
MIRT2245383	hsa-miR-510	CLIP-seq
MIRT2013105	hsa-miR-767-3p	CLIP-seq

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004969	Function	Histamine receptor activity	TAS	8522988
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	35714614, 36989299, 37327704
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17189269, 23027611, 24614691, 30853821
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	37327704
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8522988
GO:0005929	Component	Cilium	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8522988
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	17110384
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	35714614, 36989299, 37327704
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	TAS	8522988
GO:0010647	Process	Positive regulation of cell communication	IEA
GO:0016020	Component	Membrane	IEA
GO:0021795	Process	Cerebral cortex cell migration	IEA
GO:0021795	Process	Cerebral cortex cell migration	ISS
GO:0023056	Process	Positive regulation of signaling	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0032008	Process	Positive regulation of TOR signaling	IDA	23027611
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0045202	Component	Synapse	IEA
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IEA
GO:0099589	Function	Serotonin receptor activity	IDA	35714614

MIM	HGNC	e!Ensembl
601109	5301	ENSG00000158748

Protein

UniProt ID

P50406

Protein name

5-hydroxytryptamine receptor 6 (5-HT-6) (5-HT6) (Serotonin receptor 6)

Protein function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (PubMed:35714614, PubMed:36989299, PubMed:37327704, PubMed:8522988). Also has a high affinity for tr

PDB

7XTB , 7YS6 , 8JLZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	43 → 320	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in several human brain regions, most prominently in the caudate nucleus. {ECO:0000269|PubMed:8522988}.

Sequence

MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN

Sequence length

440

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cAMP signaling pathway Neuroactive ligand-receptor interaction Serotonergic synapse		Serotonin receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar I disorder	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Inhibit	35359970
Migraine Disorders	Associate	31587366
Pigmented Nodular Adrenocortical Disease Primary 1	Associate	31074783

HTR6 (5-hydroxytryptamine receptor 6)