HTR6 (5-hydroxytryptamine receptor 6)

Gene

• Entrez ID: 3362
• Gene name: 5-hydroxytryptamine receptor 6
• Gene symbol: HTR6
• Synonyms (NCBI Gene): 5-HT6, 5-HT6R
• Chromosome: 1
• Chromosome location: 1p36.13
• Summary: This gene encodes a protein that belongs to the seven-transmembrane G protein-coupled receptor family of proteins. The encoded protein couples with the Gs alpha subunit and stimulates adenylate cyclase to activate the cyclic AMP-dependent signaling pathwa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2013104	hsa-miR-1182	CLIP-seq
MIRT2013105	hsa-miR-767-3p	CLIP-seq
MIRT2013104	hsa-miR-1182	CLIP-seq
MIRT2245381	hsa-miR-1266	CLIP-seq
MIRT2245382	hsa-miR-4518	CLIP-seq
MIRT2245383	hsa-miR-510	CLIP-seq
MIRT2013105	hsa-miR-767-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004969	Function	Histamine receptor activity	TAS	8522988
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	35714614, 36989299, 37327704
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17189269, 23027611, 24614691, 30853821
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	37327704
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8522988
GO:0005929	Component	Cilium	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8522988
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	17110384
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	35714614, 36989299, 37327704
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	TAS	8522988
GO:0010647	Process	Positive regulation of cell communication	IEA
GO:0016020	Component	Membrane	IEA
GO:0021795	Process	Cerebral cortex cell migration	IEA
GO:0021795	Process	Cerebral cortex cell migration	ISS
GO:0023056	Process	Positive regulation of signaling	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0032008	Process	Positive regulation of TOR signaling	IDA	23027611
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0045202	Component	Synapse	IEA
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IEA
GO:0099589	Function	Serotonin receptor activity	IDA	35714614

Other IDs

• MIM: 601109
• HGNC: 5301
• e!Ensembl: ENSG00000158748

Protein

• UniProt ID: P50406
• Protein name: 5-hydroxytryptamine receptor 6 (5-HT-6) (5-HT6) (Serotonin receptor 6)
• Protein function: G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (PubMed:35714614, PubMed:36989299, PubMed:37327704, PubMed:8522988). Also has a high affinity for tr
• PDB: 7XTB, 7YS6, 8JLZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	43 → 320	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in several human brain regions, most prominently in the caudate nucleus. {ECO:0000269|PubMed:8522988}.
• Sequence:

  MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
  SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
  SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
  RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
  RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
  LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
  RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
  FNIDPAEPELRPHPLGIPTN

• Sequence length: 440

Pathways

KEGG:

Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse

Reactome:

Serotonin receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production