Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3360
Gene name Gene Name - the full gene name approved by the HGNC.	5-hydroxytryptamine receptor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HTR4
Synonyms (NCBI Gene) Gene synonyms aliases	5-HT4, 5-HT4R
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in bot

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments
MIRT1057276	hsa-miR-1299	CLIP-seq
MIRT1057277	hsa-miR-216a	CLIP-seq
MIRT1057278	hsa-miR-3126-3p	CLIP-seq
MIRT1057279	hsa-miR-326	CLIP-seq
MIRT1057280	hsa-miR-330-5p	CLIP-seq
MIRT1057281	hsa-miR-342-3p	CLIP-seq
MIRT1057282	hsa-miR-4717-3p	CLIP-seq
MIRT1057283	hsa-miR-496	CLIP-seq
MIRT1057284	hsa-miR-653	CLIP-seq
MIRT1057285	hsa-miR-671-5p	CLIP-seq
MIRT1057286	hsa-miR-760	CLIP-seq
MIRT1057287	hsa-miR-875-3p	CLIP-seq
MIRT1057288	hsa-miR-1205	CLIP-seq
MIRT1057289	hsa-miR-1275	CLIP-seq
MIRT1057290	hsa-miR-1909	CLIP-seq
MIRT1057291	hsa-miR-3189-3p	CLIP-seq
MIRT1057292	hsa-miR-3662	CLIP-seq
MIRT1057293	hsa-miR-4300	CLIP-seq
MIRT1057294	hsa-miR-4525	CLIP-seq
MIRT1057295	hsa-miR-4665-5p	CLIP-seq
MIRT1057296	hsa-miR-4668-5p	CLIP-seq
MIRT1057297	hsa-miR-4723-5p	CLIP-seq
MIRT1057298	hsa-miR-558	CLIP-seq
MIRT1057299	hsa-miR-625	CLIP-seq
MIRT1057300	hsa-miR-920	CLIP-seq
MIRT1057301	hsa-miR-939	CLIP-seq
MIRT2013093	hsa-miR-149	CLIP-seq
MIRT2013094	hsa-miR-3064-5p	CLIP-seq
MIRT2013095	hsa-miR-4794	CLIP-seq
MIRT1057276	hsa-miR-1299	CLIP-seq
MIRT1057278	hsa-miR-3126-3p	CLIP-seq
MIRT1057285	hsa-miR-671-5p	CLIP-seq
MIRT2245380	hsa-miR-940	CLIP-seq

Show/Hide all(41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003008	Process	System process	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	9603189, 10821780, 16102731, 35714614
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	TAS	9603189
GO:0005515	Function	Protein binding	IPI	28298427
GO:0005737	Component	Cytoplasm	IDA	15925089
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	33481771
GO:0005886	Component	Plasma membrane	IDA	10821780, 22448645
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9276448
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9351641
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	9603189
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	9603189
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	17110384
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	35714614
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IBA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IDA	16102731
GO:0016020	Component	Membrane	IEA
GO:0030277	Process	Maintenance of gastrointestinal epithelium	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0032098	Process	Regulation of appetite	IEA
GO:0051378	Function	Serotonin binding	IBA
GO:0070254	Process	Mucus secretion	IEA
GO:0070254	Process	Mucus secretion	IMP	17058067
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099589	Function	Serotonin receptor activity	IDA	33481771, 35714614
GO:0120056	Process	Large intestinal transit	IDA	33481771
GO:0150052	Process	Regulation of postsynapse assembly	IEA

MIM	HGNC	e!Ensembl
602164	5299	ENSG00000164270

Protein

UniProt ID

Q13639

Protein name

5-hydroxytryptamine receptor 4 (5-HT-4) (5-HT4) (Serotonin receptor 4)

Protein function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (PubMed:10821780, PubMed:16102731, PubMed:35714614, PubMed:9603189). Ligand binding causes a conform

PDB

5EM9 , 7XT8 , 7XT9 , 7XTA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	36 → 312	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform 5-HT4(A)]: Expressed in ileum, brain, and atrium, but not in the ventricle. {ECO:0000269|PubMed:15118808}.; TISSUE SPECIFICITY: [Isoform 5-HT4(E)]: Mainly expressed in atria and cardiac ventricle. {ECO:0000269|PubMed:15118808}

Sequence

MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT

Sequence length

388

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cAMP signaling pathway Neuroactive ligand-receptor interaction Serotonergic synapse		Serotonin receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Colorectal Cancer	Metastasis in stage I-III microsatellite instability low/stable colorectal cancer (time to event)	N/A	N/A	GWAS
Hypertension	High blood pressure / hypertension	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Pancreatitis	Acute pancreatitis	N/A	N/A	GWAS
Pelvic Organ Prolapse	Pelvic organ prolapse	N/A	N/A	GWAS

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acth Independent Macronodular Adrenal Hyperplasia	Associate	32267363
Anxiety	Associate	31977880
Autism Spectrum Disorder	Associate	31977880
Bipolar Disorder	Associate	20197377
Coronary Artery Disease	Associate	35151267
Depressive Disorder	Associate	31977880
Gastrointestinal Diseases	Associate	20197377
Glioblastoma	Associate	24358143
Hidradenitis Suppurativa	Associate	39940809
Irritable Bowel Syndrome	Associate	29089619
Lung Diseases	Associate	20010835
Lung Injury	Associate	21965014
Obesity	Associate	34872017
Pigmented Nodular Adrenocortical Disease Primary 1	Associate	27699247, 31074783
Prostatic Neoplasms	Associate	34512870
Pulmonary Disease Chronic Obstructive	Associate	21965014, 23890215, 34233669
Respiratory Tract Diseases	Associate	20010834
Schizophrenia	Associate	20197377

HTR4 (5-hydroxytryptamine receptor 4)