Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3357
Gene name Gene Name - the full gene name approved by the HGNC.	5-hydroxytryptamine receptor 2B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HTR2B
Synonyms (NCBI Gene) Gene synonyms aliases	5-HT(2B), 5-HT-2B, 5-HT2B
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin

Show/Hide all(84)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001587	Function	Gq/11-coupled serotonin receptor activity	IDA	18703043, 30127358, 36087581
GO:0001755	Process	Neural crest cell migration	IEA
GO:0001755	Process	Neural crest cell migration	ISS
GO:0001819	Process	Positive regulation of cytokine production	IDA	19023134
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	19308295
GO:0001965	Function	G-protein alpha-subunit binding	IMP	15625277
GO:0003007	Process	Heart morphogenesis	IEA
GO:0003007	Process	Heart morphogenesis	ISS
GO:0003300	Process	Cardiac muscle hypertrophy	IEA
GO:0003300	Process	Cardiac muscle hypertrophy	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	7582481, 7926008, 12970106, 15862800
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IMP	15625277
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	ISS
GO:0005515	Function	Protein binding	IPI	28258217
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	15925089
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	7926008, 12970106, 15625277, 15862800, 18703043, 19023134
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	19057895
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	15625277
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IBA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IDA	20966218, 37991948
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IDA	12970106, 30127358, 36087581
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IEA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IMP	20099302
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	ISS
GO:0007210	Process	Serotonin receptor signaling pathway	IBA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15625277
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	15925089
GO:0009410	Process	Response to xenobiotic stimulus	IDA	15862800
GO:0010513	Process	Positive regulation of phosphatidylinositol biosynthetic process	IDA	19057895
GO:0014033	Process	Neural crest cell differentiation	IEA
GO:0014033	Process	Neural crest cell differentiation	ISS
GO:0014827	Process	Intestine smooth muscle contraction	IMP	7599919, 9186750
GO:0016020	Component	Membrane	IEA
GO:0019722	Process	Calcium-mediated signaling	IMP	8882600
GO:0019934	Process	CGMP-mediated signaling	IDA	12970106
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0042310	Process	Vasoconstriction	IEA
GO:0042310	Process	Vasoconstriction	IMP	15625277
GO:0043005	Component	Neuron projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0045202	Component	Synapse	IEA
GO:0048598	Process	Embryonic morphogenesis	IEA
GO:0048598	Process	Embryonic morphogenesis	ISS
GO:0050795	Process	Regulation of behavior	IEA
GO:0050795	Process	Regulation of behavior	IMP	21179162
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IBA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	15862800
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IMP	8882600, 18566482, 18703043
GO:0051378	Function	Serotonin binding	IDA	7582481, 7926008, 12970106, 15625277, 15831837, 15862800, 17609583, 18703043, 19057895, 19307114
GO:0051378	Function	Serotonin binding	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051781	Process	Positive regulation of cell division	ISS
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IMP	19308295
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	19057895
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IDA	7926008, 16517693, 19057895
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IMP	18703043
GO:0098666	Component	G protein-coupled serotonin receptor complex	IDA	7926008, 12970106, 15862800, 18703043
GO:0098666	Component	G protein-coupled serotonin receptor complex	IEA
GO:0098666	Component	G protein-coupled serotonin receptor complex	IMP	15625277
GO:0099589	Function	Serotonin receptor activity	IDA	30127358, 36087581
GO:0099589	Function	Serotonin receptor activity	IEA

MIM	HGNC	e!Ensembl
601122	5294	ENSG00000135914

Protein

UniProt ID

P41595

Protein name

5-hydroxytryptamine receptor 2B (5-HT-2B) (5-HT2B) (Serotonin receptor 2B)

Protein function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:18703043, PubMed:23519210, PubMed:7926008, PubMed:8078486, PubMed:8143856, PubMed:8882600). Also functions as a receptor for various ergot alkaloid derivatives and psychoacti

PDB

4IB4 , 4NC3 , 5TUD , 5TVN , 6DRX , 6DRY , 6DRZ , 6DS0 , 7SRQ , 7SRR , 7SRS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	71 → 380	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Detected in liver, kidney, heart, pulmonary artery, and intestine. Detected at lower levels in blood, placenta and brain, especially in cerebellum, occipital cortex and frontal cortex. {ECO:0000269|PubMed:21179162, ECO:0000

Sequence

MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V

Sequence length

481

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction Gap junction Serotonergic synapse Inflammatory mediator regulation of TRP channels		Serotonin receptors G alpha (q) signalling events

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bardet-Biedl Syndrome	bardet-biedl syndrome	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Atrial Fibrillation	Associate	32682418
Breast Neoplasms	Associate	37682166
Carcinoma Hepatocellular	Associate	23418729
Cardiomyopathy Dilated	Stimulate	36472833
Cardiomyopathy Hypertrophic	Stimulate	36657118
Congenital myasthenic syndrome ib	Associate	33721619
Diabetes Gestational	Associate	37480094
Disease	Associate	36781042
Glucose Intolerance	Associate	37480094
Hypertension Pulmonary	Associate	15625277
Hypoxia	Associate	34472367
Neoplasm Metastasis	Associate	24597767
Neoplasms	Associate	24597767
Prader Willi Syndrome	Associate	17236194
Uveal melanoma	Associate	24597767, 30347896, 35163491, 37725244
Vascular Diseases	Associate	36781042
Wounds and Injuries	Associate	34472367

HTR2B (5-hydroxytryptamine receptor 2B)