HTN1 (histatin 1)

Gene

• Entrez ID: 3346
• Gene name: Histatin 1
• Gene symbol: HTN1
• Synonyms (NCBI Gene): HIS1, Hst1
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antif

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2245352	hsa-miR-3613-3p	CLIP-seq
MIRT2245353	hsa-miR-4519	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16203048, 34233061
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	3286634, 8336540
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	3286634, 12711380
GO:0005739	Component	Mitochondrion	IDA	35970844
GO:0005739	Component	Mitochondrion	IDA	32225006
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IMP	32225006
GO:0005783	Component	Endoplasmic reticulum	IDA	34233061
GO:0005783	Component	Endoplasmic reticulum	IDA	32225006
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	IMP	32225006
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0009893	Process	Positive regulation of metabolic process	IDA	28542418, 32225006, 35970844
GO:0009893	Process	Positive regulation of metabolic process	IMP	32225006
GO:0016020	Component	Membrane	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IDA	25903106, 28751526
GO:0031214	Process	Biomineral tissue development	IEA
GO:0031640	Process	Killing of cells of another organism	IDA	3286634
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0035470	Process	Positive regulation of vascular wound healing	IDA	28751526
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	NAS	3286634, 8336540
GO:0050832	Process	Defense response to fungus	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	3286634
GO:0090303	Process	Positive regulation of wound healing	IDA	18650243, 28542418, 34233061
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IDA	25903106
GO:1903691	Process	Positive regulation of wound healing, spreading of epidermal cells	IDA	28751526

Other IDs

• MIM: 142701
• HGNC: 5283
• e!Ensembl: ENSG00000126550

Protein

• UniProt ID: P15515
• Protein name: Histatin-1 (Hst1) (Histidine-rich protein 1) (Post-PB protein) (PPB) [Cleaved into: His1-(31-57)-peptide (His1 31/57) (His1-(12-38)-peptide) (His1 12/38) (Histatin 2) (Hst2) (Histatin-2)]
• Protein function: Histatins (Hsts) are cationic and histidine-rich secreted peptides mainly synthesized by saliva glands of humans and higher primates (PubMed:3286634, PubMed:3944083). Hsts are considered to be major precursors of the protective proteinaceous str
• Tissue specificity: TISSUE SPECIFICITY: [Histatin-1]: Submandibular and parotid glands. {ECO:0000269|PubMed:17503797}.
• Sequence:

  MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN

• Sequence length: 57

Pathways

KEGG:

Salivary secretion

Reactome:

Antimicrobial peptides