HTN1 (histatin 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3346
Gene name Gene Name - the full gene name approved by the HGNC.
Histatin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HTN1
Synonyms (NCBI Gene) Gene synonyms aliases
HIS1, Hst1
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antif
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT2245352 hsa-miR-3613-3p CLIP-seq
MIRT2245353 hsa-miR-4519 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(29)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16203048, 34233061
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region NAS 3286634, 8336540
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IDA 3286634, 12711380
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
142701 5283 ENSG00000126550
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID P15515
Protein name Histatin-1 (Hst1) (Histidine-rich protein 1) (Post-PB protein) (PPB) [Cleaved into: His1-(31-57)-peptide (His1 31/57) (His1-(12-38)-peptide) (His1 12/38) (Histatin 2) (Hst2) (Histatin-2)]
Protein function Histatins (Hsts) are cationic and histidine-rich secreted peptides mainly synthesized by saliva glands of humans and higher primates (PubMed:3286634, PubMed:3944083). Hsts are considered to be major precursors of the protective proteinaceous str
Family and domains
Tissue specificity TISSUE SPECIFICITY: [Histatin-1]: Submandibular and parotid glands. {ECO:0000269|PubMed:17503797}.
Sequence 
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
Sequence length 57
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG   Reactome
  Salivary secretion   Antimicrobial peptides
<