HSP90AB1 (heat shock protein 90 alpha family class B member 1)

Gene

• Entrez ID: 3326
• Gene name: Heat shock protein 90 alpha family class B member 1
• Gene symbol: HSP90AB1
• Synonyms (NCBI Gene): D6S182, HSP84, HSP90B, HSPC2, HSPCB
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. This gene encodes the constitutive form of the cytosolic 90 kDa heat-shock pro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016366	hsa-miR-193b-3p	Proteomics	21512034
MIRT049288	hsa-miR-92a-3p	CLASH	23622248
MIRT046508	hsa-miR-15b-5p	CLASH	23622248
MIRT044926	hsa-miR-186-5p	CLASH	23622248
MIRT044757	hsa-miR-320a	CLASH	23622248
MIRT041702	hsa-miR-484	CLASH	23622248
MIRT041702	hsa-miR-484	CLASH	23622248
MIRT041164	hsa-miR-181d-5p	CLASH	23622248
MIRT041138	hsa-miR-501-5p	CLASH	23622248
MIRT039893	hsa-miR-615-3p	CLASH	23622248
MIRT039893	hsa-miR-615-3p	CLASH	23622248
MIRT038803	hsa-miR-93-3p	CLASH	23622248
MIRT038803	hsa-miR-93-3p	CLASH	23622248
MIRT038357	hsa-miR-296-3p	CLASH	23622248
MIRT037860	hsa-miR-455-3p	CLASH	23622248
MIRT037004	hsa-miR-877-3p	CLASH	23622248
MIRT037004	hsa-miR-877-3p	CLASH	23622248
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	20371350
MIRT488267	hsa-miR-335-5p	PAR-CLIP	20371350
MIRT499217	hsa-miR-370-3p	PAR-CLIP	20371350
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	20371350
MIRT488266	hsa-miR-626	PAR-CLIP	20371350
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	20371350
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	20371350
MIRT488262	hsa-miR-4489	PAR-CLIP	20371350
MIRT488263	hsa-miR-4283	PAR-CLIP	20371350
MIRT488261	hsa-miR-185-3p	PAR-CLIP	20371350
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT540125	hsa-miR-4731-3p	PAR-CLIP	21572407
MIRT540124	hsa-miR-4801	PAR-CLIP	21572407
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	21572407
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	21572407
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	21572407
MIRT488267	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT540123	hsa-miR-5003-5p	PAR-CLIP	21572407
MIRT499217	hsa-miR-370-3p	PAR-CLIP	21572407
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	21572407
MIRT488266	hsa-miR-626	PAR-CLIP	21572407
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	21572407
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	21572407
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	23446348
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	23446348
MIRT488267	hsa-miR-335-5p	PAR-CLIP	23446348
MIRT499217	hsa-miR-370-3p	PAR-CLIP	23446348
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	23446348
MIRT488266	hsa-miR-626	PAR-CLIP	23446348
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	23446348
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	23446348
MIRT488262	hsa-miR-4489	PAR-CLIP	23446348
MIRT488263	hsa-miR-4283	PAR-CLIP	23446348
MIRT488261	hsa-miR-185-3p	PAR-CLIP	23446348
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	24398324
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	24398324
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	24398324
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	24398324
MIRT488267	hsa-miR-335-5p	PAR-CLIP	24398324
MIRT499217	hsa-miR-370-3p	PAR-CLIP	24398324
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	24398324
MIRT488266	hsa-miR-626	PAR-CLIP	24398324
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	24398324
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	24398324
MIRT488262	hsa-miR-4489	PAR-CLIP	24398324
MIRT488263	hsa-miR-4283	PAR-CLIP	24398324
MIRT488261	hsa-miR-185-3p	PAR-CLIP	24398324
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	24398324
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	23592263
MIRT488267	hsa-miR-335-5p	PAR-CLIP	23592263
MIRT488266	hsa-miR-626	PAR-CLIP	23592263
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	23592263
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	23592263
MIRT488262	hsa-miR-4489	PAR-CLIP	23592263
MIRT488263	hsa-miR-4283	PAR-CLIP	23592263
MIRT488261	hsa-miR-185-3p	PAR-CLIP	23592263
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT488261	hsa-miR-185-3p	PAR-CLIP	26701625
MIRT488267	hsa-miR-335-5p	PAR-CLIP	26701625
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	26701625
MIRT488263	hsa-miR-4283	PAR-CLIP	26701625
MIRT488262	hsa-miR-4489	PAR-CLIP	26701625
MIRT488266	hsa-miR-626	PAR-CLIP	26701625
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	26701625
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	26701625
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	20371350
MIRT488267	hsa-miR-335-5p	PAR-CLIP	20371350
MIRT499217	hsa-miR-370-3p	PAR-CLIP	20371350
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	20371350
MIRT488266	hsa-miR-626	PAR-CLIP	20371350
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	20371350
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	20371350
MIRT488262	hsa-miR-4489	PAR-CLIP	20371350
MIRT488263	hsa-miR-4283	PAR-CLIP	20371350
MIRT488261	hsa-miR-185-3p	PAR-CLIP	20371350
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT540125	hsa-miR-4731-3p	PAR-CLIP	21572407
MIRT540124	hsa-miR-4801	PAR-CLIP	21572407
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	21572407
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	21572407
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	21572407
MIRT488267	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT540123	hsa-miR-5003-5p	PAR-CLIP	21572407
MIRT499217	hsa-miR-370-3p	PAR-CLIP	21572407
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	21572407
MIRT488266	hsa-miR-626	PAR-CLIP	21572407
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	21572407
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	21572407
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	23446348
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	23446348
MIRT488267	hsa-miR-335-5p	PAR-CLIP	23446348
MIRT499217	hsa-miR-370-3p	PAR-CLIP	23446348
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	23446348
MIRT488266	hsa-miR-626	PAR-CLIP	23446348
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	23446348
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	23446348
MIRT488262	hsa-miR-4489	PAR-CLIP	23446348
MIRT488263	hsa-miR-4283	PAR-CLIP	23446348
MIRT488261	hsa-miR-185-3p	PAR-CLIP	23446348
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	24398324
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	24398324
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	24398324
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	24398324
MIRT488267	hsa-miR-335-5p	PAR-CLIP	24398324
MIRT499217	hsa-miR-370-3p	PAR-CLIP	24398324
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	24398324
MIRT488266	hsa-miR-626	PAR-CLIP	24398324
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	24398324
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	24398324
MIRT488262	hsa-miR-4489	PAR-CLIP	24398324
MIRT488263	hsa-miR-4283	PAR-CLIP	24398324
MIRT488261	hsa-miR-185-3p	PAR-CLIP	24398324
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	24398324
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	23592263
MIRT488267	hsa-miR-335-5p	PAR-CLIP	23592263
MIRT488266	hsa-miR-626	PAR-CLIP	23592263
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	23592263
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	23592263
MIRT488262	hsa-miR-4489	PAR-CLIP	23592263
MIRT488263	hsa-miR-4283	PAR-CLIP	23592263
MIRT488261	hsa-miR-185-3p	PAR-CLIP	23592263
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055873	hsa-miR-3148	CLIP-seq
MIRT1055874	hsa-miR-3163	CLIP-seq
MIRT1055875	hsa-miR-3185	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055877	hsa-miR-335	CLIP-seq
MIRT1055878	hsa-miR-3646	CLIP-seq
MIRT1055879	hsa-miR-370	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055883	hsa-miR-4668-5p	CLIP-seq
MIRT1055884	hsa-miR-4680-5p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT1055886	hsa-miR-514	CLIP-seq
MIRT1055887	hsa-miR-514b-3p	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1549642	hsa-miR-153	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT1549643	hsa-miR-448	CLIP-seq
MIRT1549644	hsa-miR-450b-5p	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1549645	hsa-miR-507	CLIP-seq
MIRT1549646	hsa-miR-557	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1549642	hsa-miR-153	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055873	hsa-miR-3148	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055877	hsa-miR-335	CLIP-seq
MIRT1055879	hsa-miR-370	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT2012819	hsa-miR-421	CLIP-seq
MIRT2012820	hsa-miR-4297	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT2012821	hsa-miR-4457	CLIP-seq
MIRT1549643	hsa-miR-448	CLIP-seq
MIRT1549644	hsa-miR-450b-5p	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055883	hsa-miR-4668-5p	CLIP-seq
MIRT1055884	hsa-miR-4680-5p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT2012822	hsa-miR-4768-3p	CLIP-seq
MIRT1549645	hsa-miR-507	CLIP-seq
MIRT1549646	hsa-miR-557	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055873	hsa-miR-3148	CLIP-seq
MIRT1055874	hsa-miR-3163	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055877	hsa-miR-335	CLIP-seq
MIRT1055879	hsa-miR-370	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT2012819	hsa-miR-421	CLIP-seq
MIRT2012820	hsa-miR-4297	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT2012821	hsa-miR-4457	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055883	hsa-miR-4668-5p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT2012822	hsa-miR-4768-3p	CLIP-seq
MIRT1055886	hsa-miR-514	CLIP-seq
MIRT1055887	hsa-miR-514b-3p	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055877	hsa-miR-335	CLIP-seq
MIRT1055879	hsa-miR-370	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT2012819	hsa-miR-421	CLIP-seq
MIRT2012820	hsa-miR-4297	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT1055886	hsa-miR-514	CLIP-seq
MIRT1055887	hsa-miR-514b-3p	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq
MIRT1055879	hsa-miR-370	CLIP-seq
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055873	hsa-miR-3148	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT2012819	hsa-miR-421	CLIP-seq
MIRT2012820	hsa-miR-4297	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT2012821	hsa-miR-4457	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055883	hsa-miR-4668-5p	CLIP-seq
MIRT1055884	hsa-miR-4680-5p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT2012822	hsa-miR-4768-3p	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055873	hsa-miR-3148	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT2012819	hsa-miR-421	CLIP-seq
MIRT2012820	hsa-miR-4297	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT2012821	hsa-miR-4457	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055883	hsa-miR-4668-5p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT2012822	hsa-miR-4768-3p	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TP53	Repression	15284248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001890	Process	Placenta development	IEA
GO:0002134	Function	UTP binding	IEA
GO:0002135	Function	CTP binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0005515	Function	Protein binding	IPI	11036079, 14743216, 15358771, 15581363, 15657067, 15870294, 16293251, 16314389, 16330544, 16531226, 16580629, 16698020, 17932509, 17979178, 18239673, 18320024, 18818696, 19375531, 20029029, 20374249, 20618441, 20650008, 21145461, 21170051, 21183720, 21360678, 21730179, 21988832, 220
GO:0005524	Function	ATP binding	IBA	21873635
GO:0005524	Function	ATP binding	IDA	10811660
GO:0005524	Function	ATP binding	IMP	10543959
GO:0005525	Function	GTP binding	IEA
GO:0005576	Component	Extracellular region	IDA	20599762
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IDA	18239673
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	10791971, 11785981, 16580629, 18239673, 24880080
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006457	Process	Protein folding	IBA	21873635
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006986	Process	Response to unfolded protein	NAS	2768249
GO:0007004	Process	Telomere maintenance via telomerase	IDA	10197982
GO:0008144	Function	Drug binding	IEA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0009651	Process	Response to salt stress	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016234	Component	Inclusion body	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0017098	Function	Sulfonylurea receptor binding	IEA
GO:0019062	Process	Virion attachment to host cell	IMP	24098578
GO:0019887	Function	Protein kinase regulator activity	IEA
GO:0019900	Function	Kinase binding	IPI	20353823, 21855797
GO:0019901	Function	Protein kinase binding	IEA
GO:0021955	Process	Central nervous system neuron axonogenesis	ISS
GO:0023026	Function	MHC class II protein complex binding	HDA	20458337
GO:0030010	Process	Establishment of cell polarity	ISS
GO:0030235	Function	Nitric-oxide synthase regulator activity	ISS
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IDA	24613385
GO:0030911	Function	TPR domain binding	ISS
GO:0031072	Function	Heat shock protein binding	IPI	20353823
GO:0031396	Process	Regulation of protein ubiquitination	IDA	16809764
GO:0031526	Component	Brush border membrane	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16207813
GO:0032092	Process	Positive regulation of protein binding	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	24613385
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	16280321
GO:0032516	Process	Positive regulation of phosphoprotein phosphatase activity	IDA	26593036
GO:0032564	Function	DATP binding	IEA
GO:0032991	Component	Protein-containing complex	IBA	21873635
GO:0032991	Component	Protein-containing complex	IDA	10811660, 23349634
GO:0032991	Component	Protein-containing complex	IMP	10543959
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	ISS
GO:0034605	Process	Cellular response to heat	IBA	21873635
GO:0034751	Component	Aryl hydrocarbon receptor complex	IDA	15581363
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035690	Process	Cellular response to drug	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042220	Process	Response to cocaine	IEA
GO:0042277	Function	Peptide binding	IPI	20599762
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042470	Component	Melanosome	IEA
GO:0042802	Function	Identical protein binding	IPI	21183720, 22939624, 30382094
GO:0042803	Function	Protein homodimerization activity	IDA	10811660
GO:0042826	Function	Histone deacetylase binding	IPI	16809764
GO:0043008	Function	ATP-dependent protein binding	IPI	10543959, 10811660
GO:0043025	Component	Neuronal cell body	ISS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044183	Function	Protein folding chaperone	IEA
GO:0044294	Component	Dendritic growth cone	ISS
GO:0044295	Component	Axonal growth cone	ISS
GO:0044325	Function	Ion channel binding	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0045597	Process	Positive regulation of cell differentiation	IMP	18239673
GO:0045793	Process	Positive regulation of cell size	IEA
GO:0046983	Function	Protein dimerization activity	IDA	7588731
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048471	Component	Perinuclear region of cytoplasm	IBA	21873635
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048675	Process	Axon extension	ISS
GO:0050821	Process	Protein stabilization	IBA	21873635
GO:0050821	Process	Protein stabilization	TAS
GO:0051082	Function	Unfolded protein binding	IBA	21873635
GO:0051131	Process	Chaperone-mediated protein complex assembly	IDA	10811660
GO:0051248	Process	Negative regulation of protein metabolic process	ISS	17517623
GO:0051897	Process	Positive regulation of protein kinase B signaling	ISS
GO:0051973	Process	Positive regulation of telomerase activity	IDA	10197982
GO:0060334	Process	Regulation of interferon-gamma-mediated signaling pathway	IMP	16280321
GO:0060338	Process	Regulation of type I interferon-mediated signaling pathway	IMP	16280321
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0070182	Function	DNA polymerase binding	IPI	10197982, 19751963
GO:0071157	Process	Negative regulation of cell cycle arrest	IMP	22843495
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0071407	Process	Cellular response to organic cyclic compound	IEA
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IEA
GO:0097435	Process	Supramolecular fiber organization	IMP	24466266
GO:0097718	Function	Disordered domain specific binding	IBA	21873635
GO:0097718	Function	Disordered domain specific binding	IPI	11785981, 15713458
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1901389	Process	Negative regulation of transforming growth factor beta activation	IDA	20599762
GO:1901799	Process	Negative regulation of proteasomal protein catabolic process	ISS	17517623
GO:1902949	Process	Positive regulation of tau-protein kinase activity	IC
GO:1903660	Process	Negative regulation of complement-dependent cytotoxicity	IEA
GO:1903827	Process	Regulation of cellular protein localization	ISS
GO:1904031	Process	Positive regulation of cyclin-dependent protein kinase activity	ISS	17517623
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1905323	Process	Telomerase holoenzyme complex assembly	IDA	10197982
GO:1990226	Function	Histone methyltransferase binding	IPI	24880080
GO:1990565	Component	HSP90-CDC37 chaperone complex	IDA	21855797
GO:1990913	Component	Sperm head plasma membrane	IEA
GO:1990917	Component	Ooplasm	IEA
GO:2000010	Process	Positive regulation of protein localization to cell surface	IDA	23431407

Other IDs

• MIM: 140572
• HGNC: 5258
• e!Ensembl: ENSG00000096384

Protein

• UniProt ID: P08238
• Protein name: Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) (Heat shock protein family C member 3)
• Protein function: Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle linked to its ATPase act
• PDB: 1QZ2, 1UYM, 2L6J, 3FWV, 3NMQ, 3PRY, 3UQ3, 5FWK, 5FWL, 5FWM, 5FWP, 5UC4, 5UCH, 5UCI, 5UCJ, 6N8W, 6N8Y, 7ULJ, 7Z37, 7Z38, 7ZR0, 7ZR5, 7ZR6, 7ZUB, 8EOA, 8EOB, 8GAE, 8GFT, 8QMO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02518	HATPase_c	35 → 189	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain
  PF00183	HSP90	191 → 712	Hsp90 protein	Family

• Sequence:

  MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
  DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
  ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
  VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
  DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
  YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
  FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
  EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
  KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
  LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
  NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
  TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRM
  EEVD

• Sequence length: 724

Pathways

KEGG:

Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Necroptosis
Antigen processing and presentation
NOD-like receptor signaling pathway
IL-17 signaling pathway
Th17 cell differentiation
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Salmonella infection
Pathways in cancer
Chemical carcinogenesis - receptor activation
Prostate cancer
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Reactome:

Regulation of actin dynamics for phagocytic cup formation
HSP90 chaperone cycle for steroid hormone receptors (SHR)
HSF1 activation
Attenuation phase
HSF1-dependent transactivation
Sema3A PAK dependent Axon repulsion
Uptake and function of diphtheria toxin
Neutrophil degranulation
The NLRP3 inflammasome
The role of GTSE1 in G2/M progression after G2 checkpoint
Aryl hydrocarbon receptor signalling
ESR-mediated signaling
Estrogen-dependent gene expression
Purinergic signaling in leishmaniasis infection

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17566973

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma	Associate	26339394
Adenocarcinoma	Stimulate	27150162
Adenocarcinoma of Lung	Stimulate	26339394
Adenocarcinoma of Lung	Associate	32649877
Alzheimer Disease	Associate	35008592, 36569892
Arthritis Rheumatoid	Associate	27898717, 34177888
Breast Neoplasms	Associate	22510516, 24880126, 25617865, 27527857, 33145341, 8878452
Burkitt Lymphoma	Associate	37569852
Carcinogenesis	Associate	22929401
Carcinoma Basal Cell	Associate	36375658
Carcinoma Hepatocellular	Associate	29271183, 31277598, 31659110, 31811111, 37515378
Carcinoma Ovarian Epithelial	Associate	33676525
Carcinoma Squamous Cell	Associate	36375658
Cardiomyopathy Dilated	Associate	27711126
Carotid Artery Diseases	Associate	29595698
Cholangiocarcinoma	Associate	29271183
Colorectal Neoplasms	Associate	27756247, 31949199, 34120619
COVID 19	Associate	34135558, 34137173, 36394763
Death	Associate	22510516
Dementia	Associate	35327643
Diabetes Mellitus	Associate	19494268
Diabetes Mellitus Type 2	Associate	24455749, 38034011
Esophageal Neoplasms	Associate	32831056
Fibrosis	Associate	31811111
Gallbladder Neoplasms	Inhibit	24833881
Glioblastoma	Associate	26108672
Glioma	Associate	37901992
Gliosis	Associate	35008592
Heart Failure	Associate	37092838
Hereditary Angioedema Type III	Associate	22510516
Hypertension	Associate	29871907
Idiopathic Pulmonary Fibrosis	Associate	23400887
Infertility Male	Associate	34580317
Inflammation	Associate	32841894
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	34217296
Leukemia Promyelocytic Acute	Inhibit	30536958
Lichen Planus Oral	Associate	39550918
Liver Failure	Associate	34135558
Lung Diseases Interstitial	Associate	23400887
Lung Neoplasms	Stimulate	22929401
Lupus Erythematosus Systemic	Associate	31124601, 37465678
Lymphatic Metastasis	Associate	22929401
Lymphoma	Associate	35572591
Melanoma	Associate	29229936
Mixed Connective Tissue Disease	Associate	23400887
Mucocutaneous Lymph Node Syndrome	Associate	38259468
Necrosis	Associate	17201177
Neoplasm Metastasis	Associate	28302086, 36375658
Neoplasms	Associate	16948864, 25435355, 26108672, 26339394, 26464709, 27756247, 29596499, 31141217, 31659110, 33428418, 39201559, 8878452
Neurodegenerative Diseases	Associate	31141217, 35008592
Non alcoholic Fatty Liver Disease	Stimulate	31885746
Obesity	Associate	24455749
Obesity	Stimulate	31885746
Osteoarthritis	Associate	22004293
Osteosarcoma	Associate	15298715, 30936265
Overweight	Stimulate	31885746
Pancreatic Neoplasms	Associate	10851351
Peritonitis	Associate	29229936
Pulmonary Disease Chronic Obstructive	Associate	34449539
Sarcoma	Associate	16948864
Skin Neoplasms	Associate	36375658
Small Cell Lung Carcinoma	Associate	26464709
Squamous Cell Carcinoma of Head and Neck	Associate	29768689
Tourette Syndrome	Associate	34449539
Triple Negative Breast Neoplasms	Associate	22510516
Uterine Cervical Neoplasms	Associate	34784845, 40446016
Venous Thromboembolism	Associate	37465678