Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
331
Gene name Gene Name - the full gene name approved by the HGNC.
X-linked inhibitor of apoptosis
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
XIAP
Synonyms (NCBI Gene) Gene synonyms aliases
API3, BIRC4, IAP-3, ILP1, MIHA, XLP2, hIAP-3, hIAP3
Disease Acronyms (UniProt) Disease acronyms from UniProt database
XLP2
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq25
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that belongs to a family of apoptotic suppressor proteins. Members of this family share a conserved motif termed, baculovirus IAP repeat, which is necessary for their anti-apoptotic function. This protein functions through bind
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs60841987 AAA>-,A,AA,AAAA,AAAAA,AAAAAA Conflicting-interpretations-of-pathogenicity, benign 3 prime UTR variant, non coding transcript variant
rs104894764 G>T Pathogenic Coding sequence variant, stop gained, intron variant
rs111978474 C>T Pathogenic Coding sequence variant, stop gained, intron variant
rs387907301 G>A Pathogenic Missense variant, intron variant, coding sequence variant
rs1556404455 T>- Pathogenic Intron variant, frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006260 hsa-miR-34a-3p Luciferase reporter assay 22161761
MIRT006260 hsa-miR-34a-3p Luciferase reporter assay 22161761
MIRT006260 hsa-miR-34a-3p Luciferase reporter assay 22161761
MIRT006260 hsa-miR-34a-3p Luciferase reporter assay 22161761
MIRT006260 hsa-miR-34a-3p Luciferase reporter assay 22161761
Transcription factors
Transcription factor Regulation Reference
AR Repression 20589722
NFKB1 Activation 15041463;15756023;16157589;18223231
NFKB1 Repression 18566231;18761050
NFKB1 Unknown 14739605;16453001;18978816
RELA Activation 15041463;15756023;18223231
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IDA 19473982, 20154138, 21931591, 22304967
GO:0005515 Function Protein binding IPI 11140638, 11257230, 11257231, 11257232, 11583623, 11602612, 11604410, 11801603, 12620238, 14685266, 16189514, 16282325, 17318174, 18022362, 19012568, 19273858, 19473982, 19549727, 19667203, 20154138, 20171186, 21185211, 21536684, 21849505, 21931591, 22117219, 22304967, 22465666, 224
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 22304967
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300079 592 ENSG00000101966
Protein
UniProt ID P98170
Protein name E3 ubiquitin-protein ligase XIAP (EC 2.3.2.27) (Baculoviral IAP repeat-containing protein 4) (IAP-like protein) (ILP) (hILP) (Inhibitor of apoptosis protein 3) (IAP-3) (hIAP-3) (hIAP3) (RING-type E3 ubiquitin transferase XIAP) (X-linked inhibitor of apopt
Protein function Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, copper homeostasis, mitogenic kinase signaling, cell proliferation, as well as cell invasion and metastasis (PubMed
PDB 1C9Q , 1F9X , 1G3F , 1G73 , 1I3O , 1I4O , 1I51 , 1KMC , 1NW9 , 1TFQ , 1TFT , 2ECG , 2JK7 , 2KNA , 2OPY , 2OPZ , 2POI , 2POP , 2QRA , 2VSL , 3CLX , 3CM2 , 3CM7 , 3EYL , 3G76 , 3HL5 , 3UW4 , 3UW5 , 4EC4 , 4HY0 , 4IC2 , 4IC3 , 4J3Y , 4J44 , 4J45 , 4J46 , 4J47 , 4J48 , 4KJU , 4KJV , 4KMP , 4MTZ , 4OXC , 4WVS , 4WVT , 4WVU , 5C0K , 5C0L , 5C3H , 5C3K , 5C7A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00653 BIR 29 94 Inhibitor of Apoptosis domain Domain
PF00653 BIR 166 231 Inhibitor of Apoptosis domain Domain
PF00653 BIR 268 331 Inhibitor of Apoptosis domain Domain
PF13920 zf-C3HC4_3 446 490 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in colonic crypts (at protein level) (PubMed:30389919). Ubiquitous, except peripheral blood leukocytes (PubMed:8654366). {ECO:0000269|PubMed:30389919, ECO:0000269|PubMed:8654366}.
Sequence
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFIN
GFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVL
GRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLL
EQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITF
KQKIFMS
Sequence length 497
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Platinum drug resistance
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Apoptosis - multiple species
Necroptosis
Focal adhesion
NOD-like receptor signaling pathway
TNF signaling pathway
Toxoplasmosis
Human T-cell leukemia virus 1 infection
Pathways in cancer
Chemical carcinogenesis - receptor activation
Small cell lung cancer
  Activation of caspases through apoptosome-mediated cleavage
SMAC (DIABLO) binds to IAPs
SMAC(DIABLO)-mediated dissociation of IAP:caspase complexes
SMAC, XIAP-regulated apoptotic response
Deactivation of the beta-catenin transactivating complex
RIPK1-mediated regulated necrosis
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
Regulation of necroptotic cell death
Regulation of PTEN localization
Regulation of PTEN stability and activity
Regulation of the apoptosome activity
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis, Familial rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)
11796754
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Esophagus neoplasm Esophageal Neoplasms, Malignant neoplasm of esophagus rs28934578, rs121918714, rs1567556006, rs1575166666 17611394
Hypofibrinogenemia Hypofibrinogenemia rs121913087, rs121913088, rs587776837, rs121909616, rs121909625, rs121909608, rs121909607, rs146387238, rs1578795296, rs1214070111, rs776817952, rs762964798, rs121909606, rs1414035000, rs1310452604
Unknown
Disease term Disease name Evidence References Source
Fulminant hepatitis Fulminant hepatitis ClinVar
Lymphoproliferative Syndrome, X-Linked X-linked lymphoproliferative disease due to XIAP deficiency GenCC
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 18432259, 22867709, 31151416, 36472768
Adenocarcinoma Bronchiolo Alveolar Associate 18432259
Adenocarcinoma of Lung Associate 22471490, 26313705
Adenoma Associate 21935275
Agammaglobulinemia Associate 23944711
Alzheimer Disease Associate 17292615, 21707856
Angioedemas Hereditary Associate 19288545, 20489057, 24611904, 25079909
Angioedemas Hereditary Stimulate 21173700
Anodontia Stimulate 16042757
Apical Hypertrophic Cardiomyopathy Associate 32797709