Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3295
Gene name Gene Name - the full gene name approved by the HGNC.
Hydroxysteroid 17-beta dehydrogenase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HSD17B4
Synonyms (NCBI Gene) Gene synonyms aliases
DBP, MFE-2, MFP-2, MPF-2, PRLTS1, SDR8C1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PRLTS1
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a bifunctional enzyme that is involved in the peroxisomal beta-oxidation pathway for fatty acids. It also acts as a catalyst for the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branch
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs25640 G>A,C Pathogenic, benign 5 prime UTR variant, missense variant, non coding transcript variant, coding sequence variant, intron variant
rs28943590 C>T Conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, intron variant, missense variant
rs34254740 T>C Likely-benign, conflicting-interpretations-of-pathogenicity Intron variant
rs73790880 A>C,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant, non coding transcript variant
rs137853096 G>A,C Pathogenic-likely-pathogenic, pathogenic, likely-pathogenic Non coding transcript variant, missense variant, coding sequence variant, 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT043174 hsa-miR-324-5p CLASH 23622248
MIRT042372 hsa-miR-484 CLASH 23622248
MIRT440484 hsa-miR-142-3p HITS-CLIP 22473208
MIRT440484 hsa-miR-142-3p HITS-CLIP 22473208
MIRT1055426 hsa-miR-1262 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000038 Process Very long-chain fatty acid metabolic process IEA
GO:0001649 Process Osteoblast differentiation HDA 16210410
GO:0003857 Function 3-hydroxyacyl-CoA dehydrogenase activity IBA 21873635
GO:0003857 Function 3-hydroxyacyl-CoA dehydrogenase activity IDA 9089413, 9482850, 10706581, 15060085
GO:0004300 Function Enoyl-CoA hydratase activity IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601860 5213 ENSG00000133835
Protein
UniProt ID P51659
Protein name Peroxisomal multifunctional enzyme type 2 (MFE-2) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-bifunctional protein) (DBP) (Multifunctional protein 2) (MFP-2) (Short chain dehydrogenase/reductase family 8C member 1) [Cleaved into: (3R)-hydr
Protein function Bifunctional enzyme acting on the peroxisomal fatty acid beta-oxidation pathway. Catalyzes two of the four reactions in fatty acid degradation: hydration of 2-enoyl-CoA (trans-2-enoyl-CoA) to produce (3R)-3-hydroxyacyl-CoA, and dehydrogenation o
PDB 1IKT , 1S9C , 1ZBQ , 6Z1W , 6Z1X , 8AF2 , 8AF3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00106 adh_short 10 212 short chain dehydrogenase Domain
PF01575 MaoC_dehydratas 480 601 MaoC like domain Domain
PF02036 SCP2 628 731 SCP-2 sterol transfer family Family
Tissue specificity TISSUE SPECIFICITY: Present in many tissues with highest concentrations in liver, heart, prostate and testis.
Sequence
MGSPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVE
EIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIH
RVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAI
EGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEA
LKPEYVAPLVLWLCHESCEENGGLFEVG
AGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLS
KIDSEGGVSANHTSRATSTATSGFAGAIGQKLPPFSYAYTELEAIMYALGVGASIKDPKD
LKFIYEGSSDFSCLPTFGVIIGQKSMMGGGLAEIPGLSINFAKVLHGEQYLELYKPLPRA
GKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKV
AVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFS
ARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISN
A
YVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNI
GAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNI
MLSQKLQMILK
DYAKL
Sequence length 736
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Primary bile acid biosynthesis
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
Peroxisome
  Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
alpha-linolenic acid (ALA) metabolism
Beta-oxidation of pristanoyl-CoA
Beta-oxidation of very long chain fatty acids
Peroxisomal protein import
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adrenoleukodystrophy Adrenoleukodystrophy, Neonatal rs128624213, rs128624214, rs1569541109, rs128624215, rs128624216, rs128624217, rs128624218, rs128624219, rs128624220, rs128624221, rs387906494, rs128624222, rs128624223, rs387906495, rs128624224
View all (125 more)
16385454, 9345094
Bifunctional enzyme deficiency Bifunctional enzyme deficiency rs1554065670, rs1554065254, rs137853097, rs25640, rs775832137, rs587777443, rs775766910, rs368744809, rs863225438, rs765702241, rs1057516672, rs1057516958, rs1057516310, rs1057516750, rs969485098
View all (34 more)
Cholestasis Cholestasis rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Unknown
Disease term Disease name Evidence References Source
Perrault Syndrome Perrault syndrome GenCC
Tremor Tremor GWAS
Associations from Text Mining
Disease Name Relationship Type References
Ataxia Associate 24602372
Breast Neoplasms Associate 19153073, 28186977, 28296597, 32968149
Carcinoma Neuroendocrine Associate 31852810
Cerebellar Diseases Associate 28830375
COVID 19 Associate 36571271
Epilepsy Associate 33115767
Fatty Liver Alcoholic Associate 36223880
Genetic Diseases Inborn Associate 20673864, 28178980
Gonadal dysgenesis XX type deafness Associate 20673864, 24602372, 26657938, 27087618, 28830375, 37932750
Hearing Loss Associate 20673864, 24602372, 33045774, 34719423