HSD17B2 (hydroxysteroid 17-beta dehydrogenase 2)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3294
Gene name Gene Name - the full gene name approved by the HGNC.
Hydroxysteroid 17-beta dehydrogenase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HSD17B2
Synonyms (NCBI Gene) Gene synonyms aliases
EDH17B2, HSD17, SDR9C2
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q23.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT022540 hsa-miR-124-3p Microarray 18668037
MIRT029366 hsa-miR-26b-5p Microarray 19088304
MIRT1055414 hsa-miR-204 CLIP-seq
MIRT1055415 hsa-miR-211 CLIP-seq
MIRT1055416 hsa-miR-4446-5p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
Transcription factor Regulation Reference
RARA Activation 18270252
RARA Unknown 17538076
RXRA Activation 18270252
RXRA Unknown 17538076
SP1 Activation 16807381;18270252
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0001890 Process Placenta development IEA
GO:0004303 Function Estradiol 17-beta-dehydrogenase activity IDA 8099587, 17538076
GO:0004303 Function Estradiol 17-beta-dehydrogenase activity TAS
GO:0005789 Component Endoplasmic reticulum membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
109685 5211 ENSG00000086696
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P37059
Protein name 17-beta-hydroxysteroid dehydrogenase type 2 (17-beta-HSD 2) (20 alpha-hydroxysteroid dehydrogenase) (20-alpha-HSD) (E2DH) (Estradiol 17-beta-dehydrogenase 2) (EC 1.1.1.62) (Microsomal 17-beta-hydroxysteroid dehydrogenase) (Short chain dehydrogenase/reduct
Protein function Catalyzes the NAD-dependent oxidation of the highly active 17beta-hydroxysteroids, such as estradiol (E2), testosterone (T), and dihydrotestosterone (DHT), to their less active forms and thus regulates the biological potency of these steroids. O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00106 adh_short 83 → 278 short chain dehydrogenase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta. {ECO:0000269|PubMed:8099587}.
Sequence 
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL
LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT
MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD
YFAKRHFGQDKPMPRALRMPNYKKKAT
Sequence length 387
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis 		  Estrogen biosynthesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Endometrial carcinoma Endometrial Carcinoma rs34612342, rs587776667, rs587776701, rs63750955, rs587776706, rs121434629, rs80359605, rs121913530, rs104894365, rs79184941, rs121913478, rs63750781, rs193922343, rs267608094, rs267608077
View all (247 more)		 23200943
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 18815356, 21232532 ClinVar
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Lung adenocarcinoma Lung adenocarcinoma Validation that loss of Tgfbr2 results in more aggressive and T cell-excluded KP lung tumors GWAS, CBGDA
Show/Hide Text Mining Associations (21)
Associations from Text Mining
Disease Name Relationship Type References
Arrest of spermatogenesis Associate 18980759
Arthralgia Associate 31678641
Breast Neoplasms Associate 19308726, 19729830
Carcinogenesis Associate 36518267
Carcinoma Endometrioid Associate 29642629
Carcinoma Hepatocellular Associate 24563232
Carcinoma Non Small Cell Lung Associate 32236582
Endometrial Neoplasms Associate 16595205, 29642629
Endometriosis Associate 16595205, 17505937, 18815356, 29664547
Hemangioma Associate 16365311