HSD17B2 (hydroxysteroid 17-beta dehydrogenase 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 3294
Gene name Hydroxysteroid 17-beta dehydrogenase 2
Gene symbol HSD17B2
Synonyms (NCBI Gene)
EDH17B2HSD17SDR9C2
Chromosome 16
Chromosome location 16q23.3
miRNA miRNA information provided by mirtarbase database.
9
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (9)
miRTarBase ID miRNA Experiments Reference
MIRT022540 hsa-miR-124-3p Microarray 18668037
MIRT029366 hsa-miR-26b-5p Microarray 19088304
MIRT1055414 hsa-miR-204 CLIP-seq
MIRT1055415 hsa-miR-211 CLIP-seq
MIRT1055416 hsa-miR-4446-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
8
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (8)
Transcription factor Regulation Reference
RARA Activation 18270252
RARA Unknown 17538076
RXRA Activation 18270252
RXRA Unknown 17538076
SP1 Activation 16807381;18270252
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (26)
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0001890 Process Placenta development IEA
GO:0004303 Function Estradiol 17-beta-dehydrogenase [NAD(P)+] activity IBA
GO:0004303 Function Estradiol 17-beta-dehydrogenase [NAD(P)+] activity IDA 8099587, 17538076
GO:0004303 Function Estradiol 17-beta-dehydrogenase [NAD(P)+] activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
109685 5211 ENSG00000086696
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P37059
Protein name 17-beta-hydroxysteroid dehydrogenase type 2 (17-beta-HSD 2) (20 alpha-hydroxysteroid dehydrogenase) (20-alpha-HSD) (E2DH) (Estradiol 17-beta-dehydrogenase 2) (EC 1.1.1.62) (Microsomal 17-beta-hydroxysteroid dehydrogenase) (Short chain dehydrogenase/reduct
Protein function Catalyzes the NAD-dependent oxidation of the highly active 17beta-hydroxysteroids, such as estradiol (E2), testosterone (T), and dihydrotestosterone (DHT), to their less active forms and thus regulates the biological potency of these steroids. O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00106 adh_short 83 → 278 short chain dehydrogenase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta. {ECO:0000269|PubMed:8099587}.
Sequence 
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL
LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT
MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD
YFAKRHFGQDKPMPRALRMPNYKKKAT
Sequence length 387
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis 		  Estrogen biosynthesis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Benign rs75102012 RCV005911763
Show/Hide Text Mining Associations (21)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arrest of spermatogenesis Associate 18980759
Arthralgia Associate 31678641
Breast Neoplasms Associate 19308726, 19729830
Carcinogenesis Associate 36518267
Carcinoma Endometrioid Associate 29642629
Carcinoma Hepatocellular Associate 24563232
Carcinoma Non Small Cell Lung Associate 32236582
Endometrial Neoplasms Associate 16595205, 29642629
Endometriosis Associate 16595205, 17505937, 18815356, 29664547
Hemangioma Associate 16365311