Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3268
Gene name Gene Name - the full gene name approved by the HGNC.
ArfGAP with FG repeats 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AGFG2
Synonyms (NCBI Gene) Gene synonyms aliases
HRBL, RABR
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and play
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018284 hsa-miR-335-5p Microarray 18185580
MIRT052062 hsa-let-7b-5p CLASH 23622248
MIRT042987 hsa-miR-324-3p CLASH 23622248
MIRT169669 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT169663 hsa-miR-20a-5p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001675 Process Acrosome assembly IBA
GO:0005096 Function GTPase activator activity IEA
GO:0005737 Component Cytoplasm IBA
GO:0007289 Process Spermatid nucleus differentiation IBA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604019 5177 ENSG00000106351
Protein
UniProt ID O95081
Protein name Arf-GAP domain and FG repeat-containing protein 2 (HIV-1 Rev-binding protein-like protein) (Rev/Rex activation domain-binding protein related) (RAB-R)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01412 ArfGap 32 148 Putative GTPase activating protein for Arf Domain
Sequence
MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDI
TVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTS
LVPDSRDPQKVKEFLQEKYEKKRWYVPP
DQVKGPTYTKGSASTPVQGSIPEGKPLRTLLG
DPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMA
PAFAAFPAFGGQTPSQGGFANFDAFSSGPSSSVFGSLPPAGQASFQAQPTPAGSSQGTPF
GATPLAPASQPNSLADVGSFLGPGVPAAGVPSSLFGMAGQVPPLQSVTMGGGGGSSTGLA
FGAFTNPFTAPAAQSPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAP
LFPPQTPLVQQQNGSSFGDLGSAKLGQRPLSQPAGISTNPFMTGPSSSPFASKPPTTNPF
L
Sequence length 481
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Achalasia Addisonianism Alacrimia syndrome Associate 37331934
Acute Febrile Encephalopathy Associate 31178128
Anaplasia Associate 30036517
Endometriosis Associate 31256999
Familial Glucocorticoid Deficiency 1 Associate 37331934
Intellectual Disability Associate 34494102
Leukemia Myeloid Acute Associate 10908574, 9050861
Myelodysplastic Syndromes Associate 10830185
Ovarian Neoplasms Associate 22074739
Pena Shokeir syndrome type 1 Associate 33168876